KEGG   Magnaporthe oryzae: MGG_03677Help
Entry
MGG_03677         CDS       T01027                                 

Definition
histone acetyltransferase GCN5
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mgr  Magnaporthe oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 400 aa AA seqDB search
MSTATEDSTNGKRKATEDPASPVSAKRPKHESPDSPEKKKPNEIARIPFPEKPAVIEERN
GEIEFRVVNNDNERESLIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEV
VGGITYRPFKGRQFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYA
IGYFKKQGFTKEITLPKSVWMGYIKDYEGGTIMQCSMLPRIRYLEMGRMLLKQKECVHAK
IRAFSKSHIVHQPPKQWKNGIEPIDPLSISAIRASGWSPDMDELARQPRHGPNYNQLLHL
LNDMQNHQSAWPFLVPVNKDDVADYYEVIKEPMDLSTMENKLEMDQYPTPEDFIRDAKLI
FDNCRKYNNESTPYAKSANKLEKFMWQQIKAIPEWSHLEP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcaacagaagatagtacaaatggcaagcgcaaagcaactgaggacccggcc
tctccagtgtcggcaaaacggccaaaacatgaatcgcccgactcacccgagaagaagaag
cccaacgagatagcacggatcccgttccccgagaagccggccgttatcgaggagcgcaac
ggcgagatagagtttcgcgttgtcaacaacgataatgagcgcgagtccctcattatcctg
accggtctgaaatgcatatttcaaaagcagctccccaaaatgccaaaggattatatcgcg
cgacttgtctacgaccgaacacatctttccatcgctattgttaaaaagcccctcgaggtc
gttggtggcatcacgtaccgcccgttcaagggtcgccagtttgcagagattgtcttttgc
gctataagcagtgaccagcaggtcaagggttatggtgcgcatctcatgtcgcatctgaaa
gactacgtgaaggccacgtcggatgtgatgcacttccttacgtacgcagacaattatgcc
attggatacttcaaaaaacaggggtttacgaaggagattacattgccaaagtcggtatgg
atgggttacatcaaggactacgagggcggcaccataatgcagtgcagtatgctcccgcgc
atacgataccttgaaatgggtcgcatgttgctgaagcaaaaggagtgcgttcatgccaag
atccgcgcattctcgaaatcccacattgttcatcagccgcccaagcagtggaagaacggc
atcgagcccatcgacccgctgtcgatcagtgcgatccgcgcctcgggctggtcccccgac
atggacgagttggcgaggcagccacgccacgggcccaactacaaccagctgctccacctg
ctcaatgatatgcaaaaccaccaaagcgcgtggccgttcctggtgcccgtcaacaaggac
gacgtcgccgactactacgaggtcatcaaggagcccatggacctgtccaccatggagaat
aagctcgagatggaccagtacccgacccccgaggactttattcgcgatgccaagctcata
tttgacaactgtcgcaagtacaacaacgagtctactccctacgcgaaatcagccaacaag
ctcgaaaagttcatgtggcagcagatcaaggccatccccgagtggtcacatcttgaacca
tga

DBGET integrated database retrieval system