KEGG   Magnaporthe oryzae: MGG_03677Help
Entry
MGG_03677         CDS       T01027                                 

Definition
(RefSeq) histone acetyltransferase GCN5
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MGG_03677
Transcription machinery [BR:mgr03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     MGG_03677
Chromosome [BR:mgr03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    MGG_03677
   HAT complexes
    PCAF complex
     MGG_03677
    STAGA complex
     MGG_03677
    TFTC complex
     MGG_03677
    SAGA complex
     MGG_03677
    SLIK complex
     MGG_03677
    ADA-HAT complex
     MGG_03677
    HAT-A2 complex
     MGG_03677
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 400 aa AA seqDB search
MSTATEDSTNGKRKATEDPASPVSAKRPKHESPDSPEKKKPNEIARIPFPEKPAVIEERN
GEIEFRVVNNDNERESLIILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEV
VGGITYRPFKGRQFAEIVFCAISSDQQVKGYGAHLMSHLKDYVKATSDVMHFLTYADNYA
IGYFKKQGFTKEITLPKSVWMGYIKDYEGGTIMQCSMLPRIRYLEMGRMLLKQKECVHAK
IRAFSKSHIVHQPPKQWKNGIEPIDPLSISAIRASGWSPDMDELARQPRHGPNYNQLLHL
LNDMQNHQSAWPFLVPVNKDDVADYYEVIKEPMDLSTMENKLEMDQYPTPEDFIRDAKLI
FDNCRKYNNESTPYAKSANKLEKFMWQQIKAIPEWSHLEP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagcaacagaagatagtacaaatggcaagcgcaaagcaactgaggacccggcc
tctccagtgtcggcaaaacggccaaaacatgaatcgcccgactcacccgagaagaagaag
cccaacgagatagcacggatcccgttccccgagaagccggccgttatcgaggagcgcaac
ggcgagatagagtttcgcgttgtcaacaacgataatgagcgcgagtccctcattatcctg
accggtctgaaatgcatatttcaaaagcagctccccaaaatgccaaaggattatatcgcg
cgacttgtctacgaccgaacacatctttccatcgctattgttaaaaagcccctcgaggtc
gttggtggcatcacgtaccgcccgttcaagggtcgccagtttgcagagattgtcttttgc
gctataagcagtgaccagcaggtcaagggttatggtgcgcatctcatgtcgcatctgaaa
gactacgtgaaggccacgtcggatgtgatgcacttccttacgtacgcagacaattatgcc
attggatacttcaaaaaacaggggtttacgaaggagattacattgccaaagtcggtatgg
atgggttacatcaaggactacgagggcggcaccataatgcagtgcagtatgctcccgcgc
atacgataccttgaaatgggtcgcatgttgctgaagcaaaaggagtgcgttcatgccaag
atccgcgcattctcgaaatcccacattgttcatcagccgcccaagcagtggaagaacggc
atcgagcccatcgacccgctgtcgatcagtgcgatccgcgcctcgggctggtcccccgac
atggacgagttggcgaggcagccacgccacgggcccaactacaaccagctgctccacctg
ctcaatgatatgcaaaaccaccaaagcgcgtggccgttcctggtgcccgtcaacaaggac
gacgtcgccgactactacgaggtcatcaaggagcccatggacctgtccaccatggagaat
aagctcgagatggaccagtacccgacccccgaggactttattcgcgatgccaagctcata
tttgacaactgtcgcaagtacaacaacgagtctactccctacgcgaaatcagccaacaag
ctcgaaaagttcatgtggcagcagatcaaggccatccccgagtggtcacatcttgaacca
tga

DBGET integrated database retrieval system