KEGG   Magnaporthe oryzae: MGG_03708Help
Entry
MGG_03708         CDS       T01027                                 

Definition
NADH-cytochrome b5 reductase 2
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
mgr  Magnaporthe oryzae
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MGG_03708
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     MGG_03708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 331 aa AA seqDB search
MFARPAIRACQSLKQPVRRYTNTPPPQSGNANNSRVGILIASAVGMAGFGTYFMFGQGTT
PAAGVKALGAEPKKALEMEKGFVSLQLDDVEVVNHNTKRLRFKLPEDDMVSGLHVASALL
TKFKPEGAEKPVLRPYTPISDEDQKGYLDLIVKKYEGGPMSTHIHELVPGQKLDFKGPLP
KYEWSANKHPHVAMIAGGTGITPMYQIMRAIFKNPADKTKVTLVVGNITEEDILLKKQLA
ELENTYPQRFRAFYVLDNPPKDWAGTKGYITKDLLKTVLPEPKEENIKVFVCGPPGMMKA
ISGNKVSPKDQGEVSGILKELGYKQDQIYKF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctcgacctgcaattcgggcctgccagtctcttaagcagcctgtgcgccgctac
acgaatacccctcctccgcaatctggaaatgccaacaactcgcgtgtcggcatcctgatt
gcgagcgccgtcggcatggccgggttcggaacatacttcatgttcggccagggcaccacg
ccggcagctggtgtcaaagccctcggcgccgagccaaagaaggcgctcgagatggaaaag
ggtttcgtgtcgctgcagctggacgacgtcgaggtcgtcaaccacaacaccaagcgcctg
cgcttcaagctgccagaggatgacatggtctcgggtctgcatgtcgctagcgccctcttg
accaagttcaagcccgaaggcgcggaaaagcccgtcctgaggccctacacccccatcagc
gacgaggaccagaagggctacttggacttgattgtcaagaagtacgagggtggccccatg
tcgacacacatccacgaactggtcccgggacagaagctggacttcaagggaccgttgccc
aagtacgagtggagcgccaacaagcaccctcacgtcgccatgattgccggcggcactggc
ataactcccatgtaccagatcatgcgtgccatcttcaagaaccccgcggacaagaccaag
gtgacgctcgtggtgggcaacatcaccgaggaggacatccttctcaagaagcagcttgcc
gagcttgagaacacctacccgcagcgcttccgcgccttttacgtcctcgacaaccctccc
aaggactgggccggaaccaagggttacattaccaaggatctgctgaagacggttctgccc
gagcccaaggaggagaacatcaaggtgtttgtgtgcgggcccccgggcatgatgaaggct
atttcgggcaataaggtcagcccgaaggaccagggcgaggtgtccggcatcctgaaagag
ttgggatacaagcaagatcaaatatacaagttttag

DBGET integrated database retrieval system