KEGG   Magnaporthe oryzae: MGG_03765Help
Entry
MGG_03765         CDS       T01027                                 

Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
mgr  Magnaporthe oryzae
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    MGG_03765
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     MGG_03765
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 445 aa AA seqDB search
MDVIQHKNASWGRAHERNTFKHQMMSVLFLLFCPLCVLVANVIMCEYQGSILSFLQATAN
GSIYRSLTAYDFQFDQSALTAYTTWVLFQAALFQYLPGKDSLGQQTPGGNILPYRTNGLQ
AWFVTHIVFGVLCWMGVVDAAIVPKLWTGLIYVTNMAGVALSIFVFFKAYIAPSYVRDRK
FSGSMVYDFQMGIEHNPRIGETFDLKLFTIGRVGMMSWTIIDISNAAYQYQKFGSVSLSI
ICVSLLHAVYVVDFFVYEDWYLRTIDIAHDHFGFYLAWGATAWMPVMYTLQAQYLGQHQT
DPSMAYVAFTFAAGLIGYYIFRTSNNHKDLVRSTDGRCTIWGAAPKFIRAKYTTSDGKLH
ESILLCSGWWGWSRHANYVGDLILSFAMCALVGTTSGIVWFYGVYMGILLIHRSYRCDKR
CRDKYGKQWDEYIRTVPYRFVPGIW
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggatgtcattcagcacaagaatgcctcatggggtcgcgcccatgaacgcaacaccttc
aagcaccagatgatgtcggtgttgttccttttgttctgccctctctgcgtcctggtcgca
aacgtcatcatgtgcgagtaccaaggctccatcctctcgttcctccaggcgaccgccaac
ggcagcatataccgatcgctcacggcgtacgactttcaattcgaccagagcgccctcacc
gcctacaccacctgggtgctcttccaggccgccctgttccagtacctgccgggcaaggac
agcttggggcagcagacgcccggaggaaacatcctcccctaccgcaccaatggcctccag
gcgtggttcgtcacccacatcgtctttggcgtcctctgctggatgggcgtcgtcgacgct
gccatcgtccccaagctttggaccggattgatctacgtgaccaacatggccggtgtggcg
ttgtcgatttttgtgtttttcaaggcctacattgcaccgtcctatgtccgtgatcggaag
tttagtggatccatggtttacgacttccaaatgggcattgagcacaaccccagaattgga
gagacttttgacctgaagctttttaccattggtagagttggaatgatgtcgtggacgata
atcgatatttccaacgccgcgtatcagtaccagaagttcggcagcgtatcgctttcaatc
atctgcgtgtccctgctgcacgccgtttacgtcgtggactttttcgtctacgaggactgg
tacctccgcaccatcgacattgcccacgaccactttggcttctacctggcctggggcgcc
accgcctggatgccggtcatgtacaccctgcaggcgcagtacctaggccagcaccagacc
gatccctccatggcctacgtcgccttcacctttgccgcgggcctgatcggctactacatc
ttcaggaccagcaacaaccacaaggacctggtccgcagcaccgacggcaggtgcaccatc
tggggcgccgctcccaagttcatccgcgccaagtacaccacctcggacggcaagctgcac
gagagcatcctgctctgcagcggatggtgggggtggtcgcgccacgccaactacgtcggc
gatctgatcctcagctttgccatgtgcgcgctcgtcggcaccaccagcggcattgtgtgg
ttctacggcgtgtacatgggcattctgctgatccaccggtcgtaccgctgcgacaagcgc
tgccgcgacaagtacggcaagcagtgggacgagtacatccggaccgtgccgtaccggttc
gtcccgggcatctggtga

DBGET integrated database retrieval system