KEGG   Magnaporthe oryzae: MGG_04012Help
Entry
MGG_04012         CDS       T01027                                 

Definition
3-hydroxyisobutyryl-CoA hydrolase
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
mgr  Magnaporthe oryzae
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MGG_04012
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MGG_04012
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MGG_04012
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MGG_04012
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     MGG_04012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 499 aa AA seqDB search
MSSRVLLGRAAWAAPSASHAFSRVGITMPLRAKILSAKPEYRAQMSTVKAQYAEDEQDVL
FSSLYGLRTIELNRPKKLNSLNLSMIKKITPRLLEWEKSDMANVIVMKGAGDKAFCAGGD
VAALAEANVKGKQGVQQSAAYFAEEYALDHLIATYQTPYIAFMDGITMGGGVGLSAHAPM
RIATERTVFAMPETNIGFFPDVGASFFLPRLDGAIGTYLGLTGETLSGANVFYTGIATHY
MHSTTLPLLESRLAELRFNDYDSMQERLAHITTAIEEYTTGLPHDQPILLAGELRQAIDR
CFSHDSVAKIVAALQNEAESGPVREWAQKTLDTLHSRSPISLHVSLRQLRIAQKWGIRET
FEKEHQLAAKFMASPDFNEGVTARLISKPKRNPNYNPAKIGDVDTESETFKNFFRPAKDL
QPIKFLNKRDFNEYPFTDFGLPRERQVRELVQTEDLSQREVISKFVALSKARLGVKEVVE
EIVYRKTVAGAHGRATWVN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcgcgtccttctaggccgcgccgcttgggcagcaccatcagcttctcacgca
ttctctcgtgtcggcatcacgatgcctttgcgagcaaaaatattatctgcgaagccagaa
tacagggcgcagatgtcgacggttaaagcacagtacgccgaagatgaacaggatgtcttg
ttcagcagcctatacggcctacgaacaatcgagctcaaccggcctaaaaaactcaactcg
ttgaacctgtccatgatcaagaaaatcacaccacggctgctcgaatgggagaaatcggac
atggccaacgtcattgtgatgaaaggcgccggggataaggcgttttgcgcaggaggtgat
gtggcagcactcgctgaagcaaacgtcaaggggaagcaaggagtccagcagtcagctgcc
tatttcgccgaggaatatgcgcttgatcaccttatcgccacatatcagacgccctacatc
gcctttatggacggaatcaccatgggaggaggtgttggcttgagcgcccatgcgcccatg
aggattgctacagagaggaccgtcttcgccatgcctgagacgaacattggcttcttcccc
gatgtgggcgcctcatttttcctccccagactggacggagccattggtacctacctgggg
ttgactggtgaaaccctctcgggagccaacgtattctacacgggtattgcgactcactac
atgcactcgacgactttgccgctgttggaatcgcgcctggccgagctgaggttcaacgac
tacgacagcatgcaggagaggcttgcacacatcaccaccgccattgaggagtacacaacc
ggtctgccacacgaccagcccattctcctggccggtgagctacgacaggccatagaccgc
tgcttcagccatgacagcgtcgcaaaaattgtggctgcattgcagaacgaagccgagtcc
gggcccgtgcgtgaatgggcgcagaagaccctggataccctgcacagccgctcgccgatc
tcccttcacgtcagcctcaggcagttgcgtatcgcccagaagtggggtatccgtgagacc
tttgagaaagagcaccagctcgcagccaagttcatggcatcacctgacttcaacgaaggt
gtcacggcgcgcctaatcagcaagccaaagaggaacccaaactacaacccggcaaagatt
ggagatgtcgacaccgagagcgagacgttcaagaatttcttcaggcctgccaaggatttg
cagcctatcaaattcctcaacaagcgcgacttcaacgaatatccattcacggactttggc
ttgccgagggagaggcaggttcgagagctggttcagaccgaggatctcagccaacgtgag
gttatcagcaaattcgtcgctctctcaaaggctaggcttggagttaaagaagtcgtggaa
gagatcgtctaccgcaagactgtggcgggcgcccatggtagggccacttgggtaaactag

DBGET integrated database retrieval system