KEGG   Magnaporthe oryzae: MGG_04031Help
Entry
MGG_04031         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGG_04031
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGG_04031
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 740 aa AA seqDB search
MNSQERWVSRQQDPRAGPGVYDPSRVLDRLHEPSILVPLVILLLSVLYTASISLPSLIRI
FWDGLVTVTPARLIFAVDGWLNPPVFPRPEMLSPAAQPTSHAAKSEALRRILGVDSGATG
LLASVSQVGRRMPGFGGGGIGGGGASKKAQVAQPAGLGNISNSCYQNSILQGLAALKPLP
AYLNIPTNSRGSDSRDSPEKGPAATLRDLISQLNDADNNGRTLWTPSVLKNMSTWTQQDA
SEYYHKLLDEVDEEITKAAQSMQKTAGLESLEPSPSPGKAPSDDGSAASLHSEDSGYHSL
SSTSKVSLVGSETFTPRNPLLGLQAQRVACVSCGWSEGLSMIPFNSITLSLGMGNQNHDL
YERLDAYTSIESIPGVECGKCTLLKAQRLINTLIERSRAGGKEPGDIPEAYARIAAINEA
LEEDDFDEKTISGRCKISQKVNSMKTKQLVIARAPQSLAIHMNRSVFDERTGQQYKNFSP
VRFPAILDLGPWCLGSAESSTADAKDDSEVPLQERSSENEPGTSSPSECDSDYERWLLDP
KKSMVAGDRQPSRIVGPIYELRAVVTHQGRHENGHYICYRKHPRPTRDSDGEKREASAPP
NLSPDGEGIDDACGDRKASSLAYGQSNVLNSETSKGSAEVAQNGSITADDDQEEDDVGWW
RLSDQNVARVSEEVVMAQGGVFMLFYDCVDPVPVLASDADADVAADPDPDADSVSRTSSR
ASQPLNDDGEDNESISDKAD
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgaattcccaggagcgttgggtctcaagacagcaggacccaagagccggccccggcgtc
tacgacccgtcgcgagtcctcgatcgtctgcacgaacctagcatcctcgtgcccttggtc
atattgctcttgtccgtactctatactgcttcgatcagcctgccatcgttgatcagaata
ttctgggacggcctggtcaccgtcacgccggcgcgcctgatattcgcagtcgacggctgg
ctcaaccccccggtgtttcctcgaccggagatgttgtctcctgcggcgcagccaactagc
catgcggccaagagcgaggcgcttcggcggatactaggcgtggattcaggagcgaccggc
ttgttggcgtccgtgtcgcaggttgggcggcgcatgcccggctttggtggtggaggaatc
ggagggggaggggcctcgaagaaagcccaggtagcccagcccgctggtctaggcaatatc
agcaactcctgctatcagaacagcattcttcaggggctggcggctctgaaaccgctgccg
gcatacttgaacatccccacaaactctaggggctccgattctcgagacagcccggaaaag
ggccccgcagctactttacgcgatctgatctcacagctgaacgatgcggacaacaacggc
cgcacattatggacaccttcagtacttaaaaatatgagtacatggacgcagcaagatgca
tcggaatactatcacaagctactcgacgaggttgacgaggaaatcaccaaggctgcgcaa
tctatgcagaaaacagctggactggaaagcctggagccgtctccctcgccaggcaaagcc
ccttctgatgacgggtctgccgccagtttgcatagtgaagacagcggctaccatagcctt
tcctcaacctccaaggtcagcctcgtgggcagtgagacctttacaccgcgcaacccgctg
ctgggacttcaggcccagcgtgtggcatgtgtatcctgtggctggtccgagggcctgtcc
atgataccattcaacagcatcaccctcagcctgggcatgggtaatcagaatcacgacttg
tatgagaggctagatgcttataccagcatcgaatcgataccgggcgttgagtgtggcaag
tgcacgctgctcaaggcgcagcgtctcattaacacgctgatcgagaggagccgtgctggc
ggaaaagagccgggggacattcccgaagcctacgctcgcatcgcagccatcaatgaggca
ctggaggaggacgactttgacgaaaagactatttctgggcggtgcaagatttcacaaaag
gtcaattccatgaagacgaagcagcttgttatagcccgcgcccctcagagcctggccata
catatgaaccggtctgtatttgatgagaggacgggccaacagtacaagaacttttcgccg
gtccgcttccctgccatcttggatctcgggccttggtgtttgggtagcgcagagagcagc
actgcggatgctaaggatgattcggaggtacctttacaagaaaggtctagcgagaatgag
cccgggaccagctcaccgtcggagtgcgacagtgattacgaacgttggctacttgaccca
aagaaatctatggtggctggcgacagacagccatcgaggatcgtcgggcccatatatgag
ctcagggctgtcgtcacccatcaaggccgacatgagaacggccactacatctgctacagg
aaacatccgcgacccacacgagactctgacggtgagaagcgtgaggctagcgcacctcca
aatttgtcaccggacggggagggcattgacgacgcgtgcggtgacagaaaggcatcatcc
ctggcatatggccagtcgaacgtcttgaactcagagacctcaaaaggcagcgcagaggtt
gcacagaatggcagcatcaccgccgacgatgatcaggaagaagacgacgtcggatggtgg
agattaagcgaccagaacgtcgcccgcgtttccgaagaggttgtcatggcgcaagggggc
gttttcatgctgttttacgactgcgtcgaccccgttcctgtgcttgcctcggatgctgac
gcggatgttgctgccgaccccgaccctgacgccgactctgtgtccaggacgtcaagtcgc
gcttctcaacctttgaatgatgacggagaggacaatgagagtatcagtgataaggcagac
tga

DBGET integrated database retrieval system