KEGG   Magnaporthe oryzae: MGG_04133Help
Entry
MGG_04133         CDS       T01027                                 

Definition
histone acetyltransferase esa-1
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MGG_04133
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 534 aa AA seqDB search
MSPHATGEAAVGSGEPRQKSKATADSLIVGCIAMVEKDGQPRRAEILSIKDTKSGRQFYC
NFDNFNKRLDEWVPLARIDLTHDVEWPNPDKDKPKEKATKKIAGAAAQSKKTAQTKRAAA
AAAAAAQKRPVGKREQSVVSEAGASHPWTEFVESQSQLKTPSSETPVTATPADEADDKMA
SAIAGLPPAAAATPASVDDMDVDGDDKTIGGVGADGRKKERQPSFSREEEIEKLRTSGSM
TQNPTEISRIRNISKVQFGRYDLFPWYFSPYPEAFSMEDCISICEFCLCYYGDVKSFTRH
CRKCTLQHPPGNEIYRDEYVSFFEIDGRRQRTWCRNLCLLSKMFLDHKTLYYDVDPFLFY
VMTTKDDKGDHLVGYFSKEKESADGYNVACILTLPQYQRKGFGRLLIQFSYELSKIEGKL
GSPEKPLSDLGLLSYRQYWGENILDLLISFHERDERCSIESIAAQLSMTTGDVEHTLQAL
RMQIYHKGEHKIVIPEKLLQQREKSKQKQKRMIDPSRIQWKPPVFNASSRTWGW
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagccctcacgcaacgggagaggccgccgttggctcgggcgagccgcggcagaagagc
aaggcgacggccgactcgctcatcgtaggctgcatcgccatggtggagaaggatggacaa
ccccggcgggccgagattttgagcatcaaggacaccaagagcggccggcagttctactgc
aactttgacaacttcaacaagcgtctggacgagtgggttccgctcgcacgcatcgacctc
acccatgatgttgagtggcccaatccggacaaggacaagcccaaggagaaggccaccaag
aagatcgccggtgccgccgcccagtcaaagaagactgcgcagaccaagagggccgccgcc
gctgctgctgctgcagcccagaagaggcctgttggaaagcgggagcagtcggtcgtctcc
gaggctggcgccagccatccatggactgagtttgtcgagtcgcagtcgcagctcaagaca
ccttcgtcagaaacccccgtcaccgcaaccccagcggacgaggccgatgacaagatggcc
tcggccatcgctggtctaccaccggccgcggcggccaccccagccagcgtggatgatatg
gacgtcgacggcgatgacaaaactatcggcggcgtgggggcggacggccgtaagaaggag
aggcaaccttctttcagtcgcgaggaggagattgaaaagctgcggacttccgggtccatg
acgcaaaatccgaccgagatatcgcgtatccgaaacatatccaaggttcagtttggtcga
tacgacctgtttccgtggtacttctcgccatatccagaggctttctcaatggaggactgc
atatcgatatgtgagttctgcctgtgctactacggagatgtcaaatctttcacgcgccac
tgccgcaaatgcacgctccagcatccgccaggcaacgaaatctaccgggacgagtacgtt
tcgttctttgagattgatgggaggcgccagcggacatggtgccgtaacctatgtctactg
tccaaaatgttcctcgaccacaagacactgtattacgacgttgacccctttctcttctat
gtcatgacgaccaaggacgacaagggcgaccatttggttggctacttctccaaggagaag
gagagtgccgacggatacaacgttgcgtgtattttgacgctacctcaataccagcgcaag
ggttttggtcggttgttgatccagttttcatacgagctttcaaagatcgaaggcaagctc
ggttcgcccgagaagccgctttcggatctgggtctgctcagttaccgacaatactggggt
gagaacattttggacctgctcatcagcttccacgagcgcgatgagcgctgcagcatcgag
tccatcgccgcacagctctccatgaccacgggtgacgtcgagcatactctgcaagctctc
aggatgcagatttatcacaaaggagagcacaagatcgtcatacctgaaaagctactgcag
cagcgtgagaagtcaaaacagaagcagaagcgcatgatcgatcccagtcgtatccagtgg
aagccacctgtgttcaatgcttcctctcgcacatggggctggtag

DBGET integrated database retrieval system