KEGG   Magnaporthe oryzae: MGG_04311Help
Entry
MGG_04311         CDS       T01027                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mgr  Magnaporthe oryzae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MGG_04311
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MGG_04311
Transfer RNA biogenesis [BR:mgr03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MGG_04311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 407 aa AA seqDB search
MFTRETTKRHHLLSRPLFWTSLAALALAFILARVIPRLDLLGNHLRTQSTTIKMATYAKE
LEVAQLAVQRAAILTKRVFNEKAKGTVSKDDKSPVTIGDFGAQALIIAALKANFPEDEIV
AEEEADALRGDEALKKTIWELVRTTKLSDEQAEKTLGGAIGSVEEMLELIDRGKSKGGDK
GRIWAIDPIDGTKGFLRGGQYAVCLGLMVDGDVKVGVLGCPNLPVDDSAPLTADLGTNAT
DEGRGVLFSGVLGQGANSRPLTTGGLADPIKKISMKPLADMASATFCESVEAGHSSQGEA
AQIAQKLGITNPSVRMDSQAKYGSIARGAGDIYLRLPTSKTYQEKIWDHAAGDLIVREAG
GQVTDTEGRRLDFSKGRTLAENKGVVAAPAAVHDKVLKAVQEVLGKN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtttacacgtgagaccacaaagagacaccatctactgagcaggcctcttttctggaca
tcacttgcagctctcgcactggcattcatccttgctagagttataccccgtctcgacctc
ctaggcaatcatcttcgtacacaatctaccacaatcaagatggccacctacgccaaggag
cttgaggtcgcgcagctggccgtgcagcgcgccgccatcctgaccaagcgcgtcttcaat
gagaaggccaagggcaccgtctccaaggatgacaagtcacccgtcacaattggcgacttc
ggagcccaggcgctcataattgccgccctgaaggccaacttccccgaagacgagatcgtc
gccgaggaggaggcggatgctctccgcggggacgaggctctcaaaaagaccatctgggag
ctggttaggacgacgaagctgagcgacgagcaggcagaaaagaccctgggcggagccatt
ggcagcgtcgaggagatgctggagctcatcgacaggggcaagagcaaggggggcgacaag
ggcaggatatgggccatcgaccccatcgacggcaccaagggtttccttcgcggcggccaa
tacgctgtctgcttgggtctgatggttgacggcgacgtcaaggtcggcgtcctcggctgc
ccgaacctgcccgtcgacgacagcgccccgctgaccgccgacttgggaaccaacgcgacc
gacgaaggccgtggcgtgctcttctccggcgtcctaggacaaggcgccaacagccggccg
ctgacgactggtgggttggccgatcccatcaagaagatctcgatgaagccgctggcggac
atggcgagcgcgaccttttgcgagagcgtcgaggccggccactcgtctcagggagaggcg
gcccagattgcccagaagctgggaatcaccaaccccagcgtaaggatggattcacaggcc
aagtatggctcgatcgcgcgcggagccggtgatatctacctcaggctgcccacgagcaag
acctaccaggagaagatctgggatcacgctgccggtgacctgatcgtgcgtgaggccggt
ggccaggttaccgatacggagggtaggaggctcgactttagcaaaggccggaccctcgct
gaaaacaagggtgtcgtggctgctccagcggccgtacatgacaaggtgctgaaggctgtc
caggaggttttggggaagaactag

DBGET integrated database retrieval system