KEGG   Magnaporthe oryzae: MGG_04311Help
Entry
MGG_04311         CDS       T01027                                 

Definition
3',5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mgr  Magnaporthe oryzae
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mgr00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 407 aa AA seqDB search
MFTRETTKRHHLLSRPLFWTSLAALALAFILARVIPRLDLLGNHLRTQSTTIKMATYAKE
LEVAQLAVQRAAILTKRVFNEKAKGTVSKDDKSPVTIGDFGAQALIIAALKANFPEDEIV
AEEEADALRGDEALKKTIWELVRTTKLSDEQAEKTLGGAIGSVEEMLELIDRGKSKGGDK
GRIWAIDPIDGTKGFLRGGQYAVCLGLMVDGDVKVGVLGCPNLPVDDSAPLTADLGTNAT
DEGRGVLFSGVLGQGANSRPLTTGGLADPIKKISMKPLADMASATFCESVEAGHSSQGEA
AQIAQKLGITNPSVRMDSQAKYGSIARGAGDIYLRLPTSKTYQEKIWDHAAGDLIVREAG
GQVTDTEGRRLDFSKGRTLAENKGVVAAPAAVHDKVLKAVQEVLGKN
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtttacacgtgagaccacaaagagacaccatctactgagcaggcctcttttctggaca
tcacttgcagctctcgcactggcattcatccttgctagagttataccccgtctcgacctc
ctaggcaatcatcttcgtacacaatctaccacaatcaagatggccacctacgccaaggag
cttgaggtcgcgcagctggccgtgcagcgcgccgccatcctgaccaagcgcgtcttcaat
gagaaggccaagggcaccgtctccaaggatgacaagtcacccgtcacaattggcgacttc
ggagcccaggcgctcataattgccgccctgaaggccaacttccccgaagacgagatcgtc
gccgaggaggaggcggatgctctccgcggggacgaggctctcaaaaagaccatctgggag
ctggttaggacgacgaagctgagcgacgagcaggcagaaaagaccctgggcggagccatt
ggcagcgtcgaggagatgctggagctcatcgacaggggcaagagcaaggggggcgacaag
ggcaggatatgggccatcgaccccatcgacggcaccaagggtttccttcgcggcggccaa
tacgctgtctgcttgggtctgatggttgacggcgacgtcaaggtcggcgtcctcggctgc
ccgaacctgcccgtcgacgacagcgccccgctgaccgccgacttgggaaccaacgcgacc
gacgaaggccgtggcgtgctcttctccggcgtcctaggacaaggcgccaacagccggccg
ctgacgactggtgggttggccgatcccatcaagaagatctcgatgaagccgctggcggac
atggcgagcgcgaccttttgcgagagcgtcgaggccggccactcgtctcagggagaggcg
gcccagattgcccagaagctgggaatcaccaaccccagcgtaaggatggattcacaggcc
aagtatggctcgatcgcgcgcggagccggtgatatctacctcaggctgcccacgagcaag
acctaccaggagaagatctgggatcacgctgccggtgacctgatcgtgcgtgaggccggt
ggccaggttaccgatacggagggtaggaggctcgactttagcaaaggccggaccctcgct
gaaaacaagggtgtcgtggctgctccagcggccgtacatgacaaggtgctgaaggctgtc
caggaggttttggggaagaactag

DBGET integrated database retrieval system