KEGG   Magnaporthe oryzae: MGG_04427Help
Entry
MGG_04427         CDS       T01027                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase 4
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mgr  Magnaporthe oryzae
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    MGG_04427
Enzymes [BR:mgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     MGG_04427
Glycosyltransferases [BR:mgr01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   MGG_04427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 774 aa AA seqDB search
MASSPATPQGSLRQRNVPGASKKNDEKSSQPVDLKDIKKAAKGQPVGPERDHQAAFTVIT
VLAFITRFWGISHPNEVVFDEVHFGKFASYYLQKTYFFDVHPPFGKLLFAFMGWLVGYDG
HFHFDNIGDSYVVNKVPYVAFRSLPALLGALTVSVVYLIMWESGYSVPACILAAGLVLFD
NAHIGQTRLILLDATLVFAFACSLLCYIKFYKMRHEPFSRKWWKWLILTGFALSCDISTK
YVGVFAFISIGSAVVIDLWDLLDVKRKDGALSLPIWAKHFSARAFGLIIMPFIFYLFWFQ
VHFAVLTRSGPGDDFMTPEFQETLSDNVMLANAITINYYDTITLRHKETKTYLHSHPDRY
PLRYDDGRVSSQGQQVTGYPFNDTNNYWQILPMNDDKQEGRVVRHQELVRLRHLGTDTIL
LSHDVASPYYPTNQEFTTCSLTDAYGDRAKDTLFEVRFENGKPGQEFKSIASHFKLIHNP
SKVAMWTHTTPLPEWGHKQQEINGNKQVTVSSNVWFVEDIPSLEADHPRRAKVEKKVRHM
PFIQKWFELQRSMFWHNSRLTSSHPYASLPYQWPFLLRGVSFWTQNDTRQQIYFLGNPIG
WWLASSLLAVYIGILAADQFSLRRGVDALDHRSRSRLYNSTGFFFLSWLTHYVPFYVMGR
QLFLHHYLPSHLASCLVAGALIEFICNSDPMDGDDVPATGGKKAVAVKPKRHITAAERFA
GKSLMVTWAVCMGILAIVIAGWYFFLPLTYGYPGLSVDQVLRRKWLGYDLHFAK
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgtcgcccgcgacgccgcaagggtcgttgcgccagcgcaatgtccccggcgca
agcaagaagaacgacgaaaagagctcccagcctgtggacctcaaggatataaagaaggct
gcaaagggccagcccgttggtcccgagcgcgatcaccaggctgccttcaccgtcataacc
gtcttggcattcatcacccgcttctggggaattagccatcccaacgaggtcgttttcgac
gaggttcactttggaaagtttgcctcgtactacctccaaaagacctacttctttgacgtt
caccctccgttcggaaagctcctcttcgcatttatgggatggctggtgggctacgacggt
cacttccacttcgacaacattggcgactcttacgtcgtcaacaaggtcccctatgtcgcc
ttccgctcgctcccggccctgctgggtgccttgaccgtatccgtcgtctacctgatcatg
tgggagtctggctacagtgtgccggcatgcattctcgccgctggtttggttctgtttgac
aatgcccacattggccagacgcgcctgatccttctcgacgccactctggtctttgccttt
gcctgcagcttgctgtgctacatcaagttctacaagatgcgccacgagccgttttccaga
aagtggtggaagtggcttatcttgaccggctttgcgctttcctgcgacatctccaccaag
tacgttggtgttttcgccttcatcagcattggatcggccgtcgtcatcgacttgtgggac
cttttggacgtgaagcgcaaggacggtgcgctgagcctgcctatatgggccaagcacttt
tctgcccgcgcattcggtctcatcataatgccctttatcttttatctcttctggttccag
gttcactttgcagtcctcacgaggtccggccccggagacgacttcatgacgcccgagttc
caggagactctgagtgacaatgtcatgctggcaaacgccatcacaatcaactactacgac
acgatcacgctgaggcacaaggagaccaagacgtaccttcacagccacccggacaggtac
cctctgcgctacgacgatggccgtgtttctagccagggtcagcaggtcaccggttacccc
ttcaacgacaccaacaactactggcagatcctacccatgaacgacgacaagcaagagggt
cgtgttgtgaggcaccaggaactcgtccgtctccgccatctcggaaccgataccattctt
ctttcccacgacgtcgcctccccctactaccctaccaaccaggagttcactacgtgctcg
ctcacggatgcatatggtgacagagccaaggacacgctgttcgaggtcaggttcgagaac
ggaaagcccggtcaggagttcaagagcatcgcctcgcacttcaagctcatccacaacccc
agcaaagtagccatgtggacacacaccaccccgctgcccgagtggggccacaagcagcag
gagatcaacggcaacaagcaggtcaccgtcagctccaacgtgtggttcgtggaggatatc
ccctcgcttgaggccgaccacccccgtcgtgccaaggtcgagaagaaggtcaggcatatg
cccttcatccaaaagtggttcgagctccagcgctccatgttctggcacaacagccgcctc
accagcagccacccttacgcctcactgccctaccagtggccattcttgcttcgcggtgtc
agcttctggacgcagaacgacacccgccagcagatttactttttgggcaaccccatagga
tggtggttggccagcagcttgctcgccgtctacattggcatccttgcagcggatcagttc
tcgctgcgccgtggtgtggatgcgcttgatcatcgctcgcgctcgcgtctgtacaactca
actggattcttcttcttgtcgtggttgacacactacgtgccattctacgtcatgggtcgt
caacttttccttcaccactacctcccctcgcaccttgcgtcctgcttggtggcgggtgcg
ctgatcgagttcatctgcaactctgacccgatggacggcgacgatgtccccgctacgggc
ggtaagaaggctgttgccgtcaagcccaagcgccacatcacggcggccgagaggtttgcc
ggcaagagcttgatggtcacatgggccgtctgcatgggtatcctcgccattgtcatcgcc
ggctggtacttcttcctgccgctcacgtacggctaccctggcctgtccgtcgaccaggtt
ctcaggcgcaagtggctcggctacgacctgcactttgctaaatag

DBGET integrated database retrieval system