KEGG   Magnaporthe oryzae: MGG_04494Help
Entry
MGG_04494         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K11874  
ubiquitin carboxyl-terminal hydrolase 16 [EC:3.4.19.12]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGG_04494
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGG_04494
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 698 aa AA seqDB search
MPEKSLQVATYAAGASLAAITLIYVFAPTYLLDSENAGRSGSSRKRGVVGLSNPANDCFI
NSILQALAGLGDLRVYLIRETHRRSLDEDDDAAKNSSETTPNRNGATSSSSRSIYRVAVP
HGGLPEWKILGLQGGVVTAGLKRILDQLNERPIAKKTASALPFVRDLEGAFRQRISRQQQ
DAQEFLQVVAERLCDEYHAGQRARRAARRREGGLEGDARAMDRRIENPAAAPTTAEAKSG
GAGSEDSGAIQTITKGAQAEDDDEDEEGFPMEGKFESQIECLTCGFKPRPKEDTFCTLTL
NVPQVSSTTLNACFDGMFKTEYIDDFKCEKCRLVHAKGVYEVELSRLPAQDTAQAEAKHR
AIEQLQLAIETDPERAPEGVPLPDARYAPKRRIARHIRMTSFPKILAVHLSRSIYERSQS
QKNSAKVAFPERLPLGGLLHRRKYKLLGVVAHKGSHHSGHYESFRRQNLYAPFSTPNAFA
GAGVYGKGAGAGTAGSVAATPATRTPRLGPLQKGDGASTSSPAVSTPDLSLSGGTGAGTP
ATTPSNSSADDAGGGGSPTTPARPSSSTSRLASLSLSPRRDKDKDKDTDSSSLRSVARST
LSRMAGSSSRSGSKRRGTVGEDQQQQQQPNGGGTSKPATASSSSPLAKTSSRRKKAKNQD
NMWWRLSDEKVKEATTKDVLGMQREVYLLFYEMEKEDE
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagaaatctctccaggtagcgacctacgccgccggcgcgtcgctcgccgccata
acgctcatctacgtgttcgccccgacgtacctcctcgacagcgagaacgccgggcggtcc
ggcagctcgcgcaagcgcggcgtcgtcggcctgtccaacccggccaatgactgcttcatc
aacagcatcctccaggcgctcgcgggactgggcgacctgcgcgtgtacctgatccgggag
acgcaccggcggtctctggacgaagacgacgacgccgccaaaaacagcagcgagacgaca
ccgaaccgcaatggcgcaacctcatcctcctcgagatccatttacagagtcgcggtgccg
cacggcgggctgcccgagtggaagatactgggtctgcagggcggggtggtcacggctggt
ctgaagcggatactggatcagctcaacgagcggccgatcgctaaaaagacagcatcggcg
ctgccgttcgtcagggacctcgagggcgctttccggcagcgcatcagccgccagcagcag
gatgcccaggagttcctgcaggttgtggctgagcgtctgtgtgatgagtatcacgccggg
cagagggcaaggcgcgctgctaggcggagggagggtggactcgagggggatgcgcgggcg
atggaccggaggatagaaaaccctgctgctgcgccgacaacagcagaagcaaagtccggc
ggtgcgggctcagaagattccggcgcaatacaaacgatcaccaagggcgcacaagcggag
gacgacgatgaggatgaggagggcttcccgatggagggaaaattcgagtcgcaaatcgaa
tgtctcacgtgcgggttcaagccgcgacccaaggaggacacattttgcacactcacgctc
aacgtgccgcaggtgtcctcgacgacgctcaacgcctgcttcgacggcatgttcaagacg
gagtacattgacgacttcaagtgcgaaaagtgccgcctcgtgcacgccaagggcgtctac
gaggtggagctctcccggctgccggcgcaggacacggcgcaggcggaggccaagcaccgg
gccatcgagcagctccagctagccatcgagaccgacccggagcgcgcccccgagggcgtc
ccgcttcccgacgcgcgctacgccccgaagcggcgcatcgcgcgccacatccgcatgacg
tcgttccccaagatcctggccgtgcacctgtcgcgttccatctacgagaggagccagtcg
caaaagaactcggccaaggtggcgttcccggagcgcctcccgctgggcggcctgctgcac
cgccgcaagtacaagctcctgggcgtcgtggcccacaagggctcccaccactcgggccac
tacgagagcttccgccgccagaacctgtacgcccccttcagcacgcccaacgcctttgcc
ggcgcaggcgtctacggcaagggcgctggcgctggcactgccggcagcgtcgccgccacc
ccggccacccggacgccgcgcctcggcccgctgcagaagggcgatggggcaagcaccagc
agtcctgcggtcagcacgccggacctgtcgctcagcggcggcacaggagccgggacgccg
gccacgacgccgagcaattcctcggctgatgatgccggtggcggtggcagcccgactact
cccgcgcgcccatcctcgagcaccagcaggctcgcgtcgctgtccctatccccgcgaagg
gacaaggacaaggacaaggatacggactcctctagcctcaggtcggtcgcgcgctcgacg
ctctcgcggatggcggggagcagcagccggagcggaagcaagcgccgaggcaccgtcggc
gaggatcagcagcagcagcagcagcccaatggtggcggcaccagcaaaccggctacggcc
agctcctcgtcccctctggccaagaccagcagcaggaggaaaaaggccaagaaccaggac
aacatgtggtggcgactcagcgacgaaaaggtcaaggaggccacgacaaaggacgtcctg
ggcatgcagcgcgaggtctacctgctgttttatgagatggagaaggaggacgagtga

DBGET integrated database retrieval system