KEGG   Magnaporthe oryzae: MGG_04545Help
Entry
MGG_04545         CDS       T01027                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     MGG_04545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 362 aa AA seqDB search
MASASRQILRAASRASTRTAFAPAASRGLAARTIAGRRFYSSSSEPAKASSSNLGWIAGA
LAAAAAGAGYWYTQNGGAATLTKPEFKDYQTVYNDIASRLEENPDYDDGSYGPVLVRLAW
HASGTYDKETGTGGSNGATMRFSPEGGHGANAGLKAARDFLEPIKAKYPWITYSDLWILG
GVCAIQEMLGPKIPYRPGRSDKDAAACTPDGRLPDAAQRQDHVRNIFYRMGFNDQEIVAL
AGAHALGRCHTDRSGFDGPWTFSPTVLTNDYFKLLLNEKWEYKKWDGPKQYVDSKTKSLM
MLPADMCLIEDKKFKEWTKKYADDNDLFFKDFSAAVLKLFELGVPFAEGTENQRWIFKPT
SE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcctctgcctctcgtcagatccttcgggctgcgtcccgcgccagcacccgcaccgcg
ttcgccccggctgcatcacgcggcctcgccgcccgcaccatcgctggccgccgcttctac
tcgtcttcgtccgagcccgccaaggcctcgtcgtccaacctcggctggattgccggtgcc
cttgccgccgctgctgctggtgccggttactggtacacccagaacggtggcgccgccacg
ctcaccaagcccgagttcaaggactaccagaccgtgtacaacgacattgccagccgcctc
gaggagaaccccgactacgacgatggtagctacggccccgtcctcgtgcgcctggcttgg
cacgctagcggtacctacgacaaggagaccggcactggcggcagcaacggtgccaccatg
cgcttctcgcctgagggtggccacggtgccaacgctggtctgaaggccgcccgtgacttc
ctggagcctatcaaggccaagtacccctggatcacctactctgacctctggatccttgga
ggcgtctgcgccatccaggagatgctgggccccaagatcccttaccgccctggtcgctcc
gacaaggacgccgctgcctgcactcccgacggccgcctgcccgacgctgcccagcgccag
gaccacgtccgtaacatcttctaccgcatgggcttcaacgaccaggagatcgttgccctg
gccggcgctcacgccctgggccgctgccacaccgaccgcagcggcttcgacggcccctgg
accttttcgcctaccgtgctgaccaacgactacttcaagctgctgctcaacgagaagtgg
gagtacaagaagtgggatggtcctaagcagtacgtcgacagcaagaccaagagcctcatg
atgctgcccgcggacatgtgcctcatcgaggacaagaagttcaaggagtggaccaagaag
tacgccgacgacaacgacctgttcttcaaggacttctctgccgctgtgctcaagctgttt
gagctcggtgtgccgttcgccgagggtaccgagaaccagaggtggatcttcaagcccacc
agcgagtaa

DBGET integrated database retrieval system