KEGG   Magnaporthe oryzae: MGG_04615Help
Entry
MGG_04615         CDS       T01027                                 

Definition
histone acetyltransferase
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
mgr  Magnaporthe oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1095 aa AA seqDB search
MASAQLMEEELQHSVMVAGAAEVDMVDYDDAPVDDADGDVDEEMETSKLGDSVLVNGKTD
KKGLVESVEPGHYDDADGDVDEDEEDEEAAEEYGEDEHDQDDSDQDDEEGDSDGEDSDGP
SEGDHEDEDLDRAAADGLRSEDDVEEEDEDEGVGAVKIKPGETDDEDDSDESEGSVGHSE
SAEESDGEASWDEAVENVEDDIEDEDKFDDLGGLCIFCKEDEDTGAYVTCRECGEKSHEH
CAKNNSAWSEKHNTTKWKCPDCASTDLAGEGDADEAEGVGLACSPITTGSASSTHGGAES
NSGRDLPAQDHLAVDEDSLDGSRVLRKRKTSSVEADEGVMSLRKRRKNTSEIRGHDDGAT
ATDELTRPQSSRSLRPKTSDSAHVSIEKKTRDTLVLKLKADPVELRRIEARPRQIPKRRG
GRTGGRSGGRSGGRFGGRGRTTRPPAQPAVQNLVAPFSAPFSSSALYQPFFFDKESEELK
GKPYGGILDEADADTSKTFPQPEDRKRFDEAKQKAEEEWRERILKMQATMTVPVKKSKKP
SGPASQIECIEFGGWEIDTWYAAPYPEEYSRNRVLYICEFCLKYMNSDYVAWRHKLKCPA
KHPPGDEIYRHGSVSVFEVDGRKNPVYCQNLCLLAKLFLGSKTLYYDVEPFLFYVLCEYD
EYGYHFVGYFSKEKRASSQNNVSCILTLPIHQRKGYGNLLIDFSYLLTRVEKKTGSPEKP
LSDMGLVSYRNYWRLVLCQYFIEHVPEDKEKQIGLSVKQISDDTGMTADDVVAALEGLRC
LVRDPQTELYAFRVDLPFCKEYVEKWQAKKYVKLDPRFLTWTPYVMGRGNATNFELGPAL
NAIAPREDEEEPKLTEPAITVLPNGETSVVYAAATANGEVKDGGATNGVPTVLQSTEAHD
DMVKPAAEQNVELQPSIEGVREMSVVNEVTSNMDKDLPEGKWMSLYKAIPPTRFQVFPPI
SRKVERPRAAVVRIPVAQPVALPRPKPKRPAGPRRSAPAKKQKGKSSTTRVRKAGGTGRG
PGRWPKGTKKSDYGNADSGPGLPPAWIAARLAAQTSKGSGGESNVTPDSKDTAAAKIDGK
AEDTVQVLTPIVKEV
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgcccagctaatggaggaggagctgcagcacagtgtgatggttgcgggggct
gccgaagtcgacatggttgactacgatgatgcgccagtcgatgatgccgacggcgacgtc
gacgaagagatggaaacttcgaagttgggtgattctgtcctggtcaacggcaaaacagac
aaaaaaggcctggttgaaagcgtggagcctggtcactacgacgacgctgacggtgacgtt
gacgaggatgaagaagacgaggaagctgccgaagaatacggggaagacgaacacgatcaa
gatgatagcgaccaggatgacgaagaaggcgattcggacggagaggatagtgatggaccc
tcagagggtgaccatgaagatgaagacctggaccgtgcagcagcagatggtctcagatca
gaggacgatgttgaagaggaggacgaagacgaaggcgttggtgccgtcaagatcaagccg
ggcgaaacggacgacgaagatgacagtgacgagagtgaaggctcagtaggccacagtgaa
agtgccgaggagtctgacggggaggcctcatgggacgaagccgttgaaaacgtcgaagac
gacatagaagacgaagataagttcgacgaccttggcggcctttgtatattctgtaaggaa
gacgaggatacgggcgcatatgtcacctgcagagaatgtggggagaagtcacacgagcac
tgcgccaagaataattctgcgtggagtgaaaagcacaacaccacaaaatggaaatgtcca
gattgcgcatcaacagatttggccggcgaaggagatgcagatgaagcagaaggagtgggg
cttgcttgctctcccataactacaggatcggcctcttccacacacggtggcgcagaatca
aattctggtcgtgatctcccagcccaagaccacctcgcagtagatgaggattccttggat
ggttctcgtgtgctcagaaagcgcaagacatcatctgtggaggccgacgagggcgtgatg
tcgttgcgaaagcggcgcaagaacacatcagagatccgaggtcatgatgatggcgcaaca
gccaccgatgaacttacaaggcctcagtcctcccggtcattgagaccaaagacgtccgac
tctgctcatgtcagcatcgagaagaaaacccgagatactcttgtcctcaagctcaaggcc
gatcctgttgagctgaggcgtatagaggctcgaccacgacagattcctaagcgccgtggt
ggtagaacgggcggtcgctctggtggccgatctgggggccgattcggcggcaggggacgc
acaacacgccctccggctcaaccagctgtacaaaatttggtggcgccattttcagcccca
ttttcttcctcggcattgtatcaacccttcttttttgacaaggaatcagaagagctaaaa
ggcaagccatacggcggtatcctcgacgaagccgatgcggatactagcaagactttcccg
cagccggaggatcgcaagcgctttgatgaggcaaaacagaaggctgaggaggagtggcga
gagcggatcctcaaaatgcaggcaaccatgacagtgcctgtcaaaaaatcaaaaaaaccg
tcagggccggccagccagatcgaatgcatcgagtttggcggctgggaaatcgacacatgg
tatgcggccccttatccggaggagtacagcagaaaccgtgttctgtacatttgcgagttc
tgcttgaagtacatgaactcggactacgtggcatggcgtcacaagctcaagtgtcctgcg
aagcatcctccgggcgatgagatttaccgccatggatccgtctcggttttcgaggtcgat
ggccgcaaaaatccggtgtattgccagaatctttgcttgctggctaagctgttccttggg
tcaaagaccctgtactacgacgtcgaaccattcttgttctacgtactgtgcgagtacgat
gagtatggctatcactttgtcgggtacttttccaaggagaagcgagccagcagccaaaac
aacgtcagctgtatcttgaccctgccgatacatcaacgaaagggatacggaaacttgctc
atcgacttttcctacctactcacccgcgtggaaaagaagacgggctcgcccgagaagcca
ttatcggacatgggcttggtctcttacaggaactattggcggctggttctttgccaatac
ttcatcgagcacgtcccagaggacaaagaaaaacagataggcctcagcgtgaagcaaatc
tccgacgacacaggcatgacagctgacgatgttgtcgccgcgttggagggtctaagatgt
ttggtgcgagacccacaaaccgaattgtatgccttcagggtagatttacctttctgcaag
gagtacgtcgagaagtggcaggccaaaaagtacgtcaagcttgatccgcgctttctcacg
tggacaccgtacgtcatgggtagaggcaacgcaacgaactttgagttgggcccggctctt
aatgccatcgcgccccgcgaggacgaggaagagccaaaactcacggagcctgccatcacg
gttcttccaaacggggagacctctgttgtttatgccgctgccaccgcaaacggtgaagtg
aaagatggcggcgcaacgaatggagtccctactgtgcttcagtccactgaagctcatgac
gacatggtaaagccagcggctgaacaaaatgtcgaacttcaaccaagtatcgaaggggtc
agagagatgagtgttgtgaatgaggtaacgtccaacatggataaggaccttcccgaaggg
aagtggatgtctctttacaaggcaatccccccaacgcgttttcaggtgtttcctccgata
tcccgcaaggttgagcgaccgagggcggcagttgtacggataccagttgcacaacctgtg
gctcttccccgccccaagcctaaacgtccagcagggccgcgccgttcagcaccagcgaaa
aagcaaaagggcaaaagctccaccacacgggttcgcaaggcaggcggaacaggccgagga
cctggcagatggcccaagggaaccaagaagagcgattacggcaatgctgacagcgggcca
ggactccctccggcatggattgctgccagacttgcagctcaaacatccaagggtagtgga
ggggagtcaaacgtcacaccggacagcaaagacacagcagctgccaagattgatggtaaa
gctgaagataccgtgcaagttctgacacccattgttaaggaggtctag

DBGET integrated database retrieval system