KEGG   Magnaporthe oryzae: MGG_04647Help
Entry
MGG_04647         CDS       T01027                                 

Definition
eukaryotic translation initiation factor 4E-1
Orthology
K03259  
translation initiation factor 4E
Organism
mgr  Magnaporthe oryzae
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGG_04647
Translation factors [BR:mgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    MGG_04647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 244 aa AA seqDB search
MSTQVDLSTIPISPDGENAPTSSGDKEVTVFHDSNNFNVKHPLMHKWTLWFTKPPTGKGD
NWAELLKEVITFNSVEEFWGIYNNIAPVSELALKSDYHLFKEGVRPEWEDPQNKHGGKWS
YSFKEKRNIPIDDIWLHTMLAAIGETLESEDDGEVMGVVVNVRKAFYRVGVWTRTTGKSI
PNRGDGDVAGGKGRSPEKGRAILMDIGKRFKDVLRLPANEVLEFSGHTESAHSGSTRAKA
KFTV
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgtctacccaagtcgatctctcgacgattcccatctctcccgatggagagaacgcgcct
acttcatccggcgacaaggaggtcacagtctttcacgacagcaacaacttcaacgtcaag
caccccttgatgcacaaatggaccctttggttcaccaagccaccaactggcaagggcgac
aactgggctgagcttcttaaggaagttatcacatttaactcagtagaggagttctggggc
atctataacaacattgcccccgtctcggagctggcgttgaagtcggactaccatcttttc
aaggagggcgtgcgaccagaatgggaggacccccaaaacaagcacggtggcaagtggtcc
tacagcttcaaggagaagcgcaacattcccatcgacgatatctggctgcacaccatgctg
gccgcgatcggcgagactctggagtcggaggacgatggtgaggtcatgggcgtcgtcgtc
aacgtgcgcaaggctttctaccgtgttggtgtgtggactcgcaccaccggcaagtccatc
cccaaccgtggtgatggtgacgttgctggaggcaagggtcgctcgcctgagaagggcagg
gcaattctcatggatattggcaagcgcttcaaggatgtcctgaggctcccagccaacgag
gttcttgagttctcgggtcacaccgagtctgcacacagcggcagcacccgtgccaaggcc
aagttcacagtctaa

DBGET integrated database retrieval system