KEGG   Magnaporthe oryzae: MGG_04895Help
Entry
MGG_04895         CDS       T01027                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:mgr01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mgr00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 547 aa AA seqDB search
MASKNMVNPAVEPSMEDDLFAREVAEVKQWWSDPRWRYTKRPFTAEQIVSKRGNLKIEYP
SNAQSKKLWKILEGRFQKRDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASSSDEP
GPDLADYPYTTVPNKVSHLFMAQLFHDRKQRHERLSAPKSERSKLQNIDYLRPIIADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQA
DIMGVDLLAIARTDAEAATLITTSIDPRDHAFILGCTNPSLQPLADLMNTAEQSGKTGDQ
LQAIEDEWMAKANLKRFDDAVVDVINSSSSIRNPKDVAAKYLQAAKGKSNREARAIASSL
GVPEIFFDWDSPRTREGYFRIKGGCDCAINRAIAYAPYADAIWMESKLPDYEQAKEFAEG
VHAVYPEQKLAYNLSPSFNWKTAMPRDEQETYIRRLAGLGYCWQFITLAGLHTTALISDR
FARAYSEVGMRAYGELVQEPEMELGVDVVKHQKWSGATYVDELQKMVTGGVSSTAAMGKG
VTEDQFH
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaaaaacatggtgaatcctgctgtcgaacccagcatggaagacgacctgttt
gccagagaagtggccgaggtcaagcagtggtggagtgacccccgttggaggtacaccaag
cggccattcactgccgaacaaattgtatccaagcgaggcaacttgaagattgagtatcca
agcaacgcacaatctaagaagctgtggaagattctcgagggccggttccagaagcgcgat
gccagttacacctatggctgcttggagccaacaatggtgacccagatggccaagtaccta
gacacggtctatgtttccggctggcagtcatcctctacagcgtcgtcctctgatgagccg
ggcccggatttggcagactacccctataccaccgttccgaacaaagtgtctcacttgttc
atggcacaactgttccacgaccggaaacagcgtcatgagcgtctttcggcgcccaagtcg
gagcggtctaagcttcagaatatcgactacctgcgacccattattgccgatgccgacact
ggccatggaggtttgacagcggtgatgaagctgacgaaactcttcatcgagaagggagca
gctggtatccacattgaggaccaggctcctggcacaaagaagtgtggacacatggcgggc
aaggtcctggtgcccatcagcgagcacatcaaccgcttggttgccattcgggcgcaggcc
gacatcatgggtgtcgaccttctcgcaattgcgcgtaccgatgccgaggctgccacgctg
atcacgaccagcatcgacccccgtgaccacgccttcatcctcggctgcacaaacccgagc
ctgcagccgcttgccgatctcatgaacactgcagagcagtctggaaagactggcgatcaa
ctgcaggccattgaggacgagtggatggcaaaggcaaacctgaagcgcttcgacgacgca
gttgttgacgtgatcaactcttcctcgtccattcgcaacccgaaggatgtggccgcaaaa
tacctgcaggccgccaagggcaagagcaacagggaagccagagccattgcaagcagcttg
ggcgttcccgaaatctttttcgactgggactcgccccgcacgcgtgagggatacttccgc
atcaagggtggctgtgattgcgccatcaaccgtgccattgcctacgcgccatacgccgat
gctatctggatggagagcaagctgcctgactacgaacaggcgaaggagtttgccgagggc
gtgcacgctgtgtaccccgagcaaaaacttgcgtacaacctttcaccttccttcaactgg
aagacggccatgccgagagacgagcaggagacgtacatcagacgcctggcgggtctgggc
tactgctggcagttcatcacgctcgcgggtctgcacacgacggcgctcatcagcgaccgc
ttcgcgcgtgcgtactccgaggtcggcatgagggcgtatggcgagcttgtgcaggagccc
gagatggagcttggcgtcgatgtcgtcaagcaccaaaagtggagtggcgcgacgtatgtc
gacgagctgcagaagatggtgacgggtggtgtgagcagcaccgctgccatgggcaaggga
gtgacagaagaccaattccactga

DBGET integrated database retrieval system