KEGG   Magnaporthe oryzae: MGG_04920Help
Entry
MGG_04920         CDS       T01027                                 

Definition
palmitoyl-protein thioesterase 1
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mgr  Magnaporthe oryzae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MGG_04920
  Lipid metabolism
   00062 Fatty acid elongation
    MGG_04920
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     MGG_04920
Lipid biosynthesis proteins [BR:mgr01004]
 Fatty acid synthase
  Component type
   MGG_04920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 332 aa AA seqDB search
MSLSYYLKHLFLGSLVTSTLARPQQKPLADDDDDTPLPVVIWHGLGDDYSAQGLRQVGEI
VEAANPGTFVYFIRMDDNASQDRSATFFGNLTEQVQKVCDDIASHPILSTAPAIDALGFS
QGGQFLRAYVERCNSPPVRSLVTFGSQHNGIIDFKACSATDFLCKGAMALLRGNTFSQFV
QSRLVPAQYFRDPANNYDKYLESSNFLADINNERALKNQTYKKNLAKLVNFVMFAFDEDT
TVIPRETAWFEEVNGTEVIPLRARKLYTEDWIGLRELDRNGGLKLRTCPGEHMQLSDELL
NKTFTEFFGPNNKKFGMGGQAGDLDVTREDEL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctatcatactatttgaaacatttgttcttggggtcactggtgacctccacgctg
gctcgtccccagcaaaagccccttgctgacgatgatgacgacacccctctgccggtagtg
atctggcatggacttggcgatgattactcggcccagggccttcgtcaggttggcgagatt
gtcgaagcggccaaccctggaacctttgtatacttcatccgcatggacgacaatgcatca
caggatcgcagcgcgacctttttcggcaacctgacggagcaggtacagaaggtctgcgac
gacattgccagccaccccattctctcgacggcccctgccatcgacgcgctcggcttcagc
cagggcggccagttcctacgtgcgtacgtcgagcgctgcaactcgcccccggtccgcagc
ctggtcacgtttggctctcagcacaacggaatcattgacttcaaggcctgctccgccacc
gacttcctctgcaagggcgccatggccctacttcgcggaaacaccttttcgcagtttgtg
cagagccgtctggtgcccgcgcagtacttccgcgacccggccaacaactatgacaagtac
ctcgagtccagcaacttcctggccgacatcaacaacgagcgcgcgctcaagaaccagacc
tacaagaagaaccttgccaagctggtcaactttgtcatgtttgccttcgatgaagacacc
accgtcatcccaagggagacggcgtggtttgaggaggtcaatggcaccgaggtcatccct
cttcgcgccagaaagctttatacggaggactggatcggtctccgtgagctggaccgcaac
ggtggcttgaagctgaggacctgtcccggcgagcacatgcagctttctgatgaattgctc
aacaagacattcactgagttctttgggcccaacaacaagaagtttggcatgggcggccaa
gcgggtgatctggatgtcacgcgggaagacgagctttag

DBGET integrated database retrieval system