KEGG   Magnaporthe oryzae: MGG_04920Help
Entry
MGG_04920         CDS       T01027                                 

Definition
palmitoyl-protein thioesterase 1
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mgr  Magnaporthe oryzae
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mgr01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:mgr00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 332 aa AA seqDB search
MSLSYYLKHLFLGSLVTSTLARPQQKPLADDDDDTPLPVVIWHGLGDDYSAQGLRQVGEI
VEAANPGTFVYFIRMDDNASQDRSATFFGNLTEQVQKVCDDIASHPILSTAPAIDALGFS
QGGQFLRAYVERCNSPPVRSLVTFGSQHNGIIDFKACSATDFLCKGAMALLRGNTFSQFV
QSRLVPAQYFRDPANNYDKYLESSNFLADINNERALKNQTYKKNLAKLVNFVMFAFDEDT
TVIPRETAWFEEVNGTEVIPLRARKLYTEDWIGLRELDRNGGLKLRTCPGEHMQLSDELL
NKTFTEFFGPNNKKFGMGGQAGDLDVTREDEL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctatcatactatttgaaacatttgttcttggggtcactggtgacctccacgctg
gctcgtccccagcaaaagccccttgctgacgatgatgacgacacccctctgccggtagtg
atctggcatggacttggcgatgattactcggcccagggccttcgtcaggttggcgagatt
gtcgaagcggccaaccctggaacctttgtatacttcatccgcatggacgacaatgcatca
caggatcgcagcgcgacctttttcggcaacctgacggagcaggtacagaaggtctgcgac
gacattgccagccaccccattctctcgacggcccctgccatcgacgcgctcggcttcagc
cagggcggccagttcctacgtgcgtacgtcgagcgctgcaactcgcccccggtccgcagc
ctggtcacgtttggctctcagcacaacggaatcattgacttcaaggcctgctccgccacc
gacttcctctgcaagggcgccatggccctacttcgcggaaacaccttttcgcagtttgtg
cagagccgtctggtgcccgcgcagtacttccgcgacccggccaacaactatgacaagtac
ctcgagtccagcaacttcctggccgacatcaacaacgagcgcgcgctcaagaaccagacc
tacaagaagaaccttgccaagctggtcaactttgtcatgtttgccttcgatgaagacacc
accgtcatcccaagggagacggcgtggtttgaggaggtcaatggcaccgaggtcatccct
cttcgcgccagaaagctttatacggaggactggatcggtctccgtgagctggaccgcaac
ggtggcttgaagctgaggacctgtcccggcgagcacatgcagctttctgatgaattgctc
aacaagacattcactgagttctttgggcccaacaacaagaagtttggcatgggcggccaa
gcgggtgatctggatgtcacgcgggaagacgagctttag

DBGET integrated database retrieval system