KEGG   Magnaporthe oryzae: MGG_04957Help
Entry
MGG_04957         CDS       T01027                                 

Definition
ubiquitin carboxyl-terminal hydrolase 2
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
mgr  Magnaporthe oryzae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MGG_04957
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MGG_04957
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGG_04957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1036 aa AA seqDB search
MVPPPSASVSSASYTFTTSTAGGRMNADAPLNGRPGKPPLPHIDDLLNPPVNIDAFAPIE
TVIAQGENHLRSAESLKGFGRPHMALKEYVSATVVAVEAVPRNKGFGSLSDRKQLAARHT
ALMRKIQALHPDFEKVKAAVKLDNQKSGVRPQRASSSSTQANGHAQPGLQSNGSAVKPVA
SQQPLSGNGAVPSPGYSQDAAQHAANGIPTRRPAPHPKPQALHGNSVLTGPNGAGPSSPP
VQDLAERFANLRGGKNGAGVPSPRPLGSAGSRPTPGQVAGISVLSDIPADFPKVPEAIYS
PARGTVSNESANLPSSNSRGMFSRAASSTSMASQGKQPLGREDYSAPANNEQAKPPPARP
QPRIPDGDTVTPEQLFEFMRCSSVNFKVLIIDVRTREEFNEGHIMSTSIICVEPDVLQRE
HISADDIAQSLILAPPREEEIFSRRSEYDLVVFYNQDSQEINWRGGTPAENALFGLYNAL
RHFDYDLTGDSKPAKLLKGGLDAWVELVGENALERSETSGAIHKIQHAKSRFSLSRGQGR
PKAKPIQNAEDARRWNEKLTTEGQSIVRTQEEFLRRFPAVSDVQESMTAPVTQATRGFPA
SADINNTMLAPPARPARTRTRQNYTGLMETGEEELYTPVATESRALSRRERRPVGLSNPG
VWCYSNASIQALFHSSGFVDELIGEEWQSRWKVPMRDGEKLENHQFLSKILSNLFHWMLN
GQFESMECRTLMEYCNFIDRNTATFDNGENLTKGEREAFGSRHKQQDAEEFISFLMDHLH
DETNRLRNKNFDPSSLVFGKENHQNALTFWNGWCSANDSVIDRYWRGLSQNVVRCRTCNH
TNYSHEAFNKIQVPVPEARGPCKLVDLLPGGFSYNELLDGYKCDGCSRMNTTSSTVRLAR
LPKLLCISLSRFSVDRGDTRKNNTKVVFPLDDLNLAAVSDPTPSGEGIGEEWTGPFRYYC
YAAVLHGGTLRSGHYTAFVRDQNPSRNGGVWYHCNDSIISTKTIRNEEDADAAGMYAADS
ESSAYILFYSRQPVAK
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgccaccctccgcctccgtatcctcggcatcctatactttcaccacatcaacg
gcgggtggcagaatgaacgccgatgcaccccttaacggccgccccggcaagccaccgcta
ccgcacatcgatgacctcctcaacccacctgtcaatatcgatgccttcgcccccatcgag
accgttatagcacagggcgaaaatcacctcagaagtgctgagtctctcaagggctttggc
cgtccccatatggccctgaaagagtacgtttcagctaccgtagtagctgtcgaggccgtt
ccaaggaacaagggtttcgggtctctttcggataggaagcagctggctgcacgtcatacg
gctttgatgcgcaagatccaggccttgcatcctgatttcgagaaggtcaaagcagctgtc
aagctggacaaccaaaaaagcggcgtgcggcctcaacgtgccagctcgtcatcaacgcag
gccaatggccatgcgcagccagggctacaatcgaatgggagtgcggtaaagccggtagca
tcacagcagcctttgtccggcaacggagctgtgcctagtcccggatacagccaagatgcc
gctcagcatgcagcaaacgggattcccaccaggaggccagcgccgcatccgaagccccaa
gccttgcatggaaactctgtactgactgggccaaacggcgccggtccttccagtcctcca
gtacaagatcttgctgaacgttttgcgaatttgcgaggtgggaaaaatggagctggcgtc
ccatcaccacgaccgttgggatcagcagggtcacggcctacaccaggccaagtcgctgga
atatcagtactcagcgacatccccgccgatttccccaaggtacccgaggccatttacagc
ccagcgaggggcaccgtttccaatgagtccgcgaacctgccctcaagcaattcgagggga
atgttcagccgggcagcttcttccacgtcgatggcttcgcagggcaagcaacctctgggc
agagaggattattcggcccctgcaaataatgaacaagcaaagccacccccagcccgtcct
cagccccgaattccagatggagatactgtaacgccagaacagttatttgagttcatgcga
tgctcatccgtcaactttaaggttctgataattgatgtgagaaccagggaggaattcaac
gaaggccacataatgtcaacgtcaatcatttgtgtggagcctgatgtgctacagcgtgaa
catatttctgcagatgatatcgcgcagagcctgattctcgcacctccccgcgaggaagaa
atcttcagccgacggagtgaatacgacctcgtcgtcttctacaaccaagattcccaggag
atcaactggcggggcggaacaccagcagagaatgctttgttcggcctgtacaatgctctc
aggcactttgattacgatctgacaggggacagcaagccagcgaagctcctcaagggcggg
ctcgatgcctgggttgaacttgtcggcgaaaatgctctagaaaggtctgaaacctctggt
gcaatccacaagatccaacacgccaagtcgcggttttctctgtcgcgtggtcagggcaga
ccaaaagcaaagcccatccagaatgccgaagatgctagacgttggaatgaaaagctcact
actgaggggcagagtattgttcgtacacaagaggaattcctgaggagattccctgcagtc
agcgatgtgcaagagtcaatgactgcgccggtcacgcaagctacgaggggtttccctgcc
tcagcagatatcaacaacacaatgcttgcaccgccagctcgtccggcccggacccggacc
cgacagaactacaccggcctgatggaaactggcgaggaggaactatacacaccagtcgct
acggaatccagggctctttcgcgaagagagcgacgcccagtcggcctctcgaatcccggt
gtctggtgctactccaatgcatcaatacaggccctttttcactcgagtggcttcgtcgac
gagttgatcggcgaggagtggcaaagtcgatggaaagtaccgatgcgcgatggagagaaa
ttggagaaccaccaattcctgtccaaaatcttgtccaatctgttccactggatgttaaat
ggccaattcgaatcgatggagtgtagaactttgatggaatattgcaacttcatcgaccgc
aacacagcgacttttgacaacggagagaatctgacaaagggggagcgggaagcttttggc
agcagacacaagcagcaggacgctgaggagttcattagcttcttgatggaccacctccac
gacgagacaaatcgtctgcggaacaagaattttgatccatccagcttggtatttggtaaa
gaaaatcaccagaatgccttgaccttctggaacgggtggtgctcggccaacgactcggtt
atcgaccgttactggcgtggtctgtcgcaaaacgtggtccgctgcagaacctgtaaccac
accaactacagccatgaggccttcaacaagatccaagttccagtcccggaagcaaggggg
ccgtgcaagttggtagacttattgccaggcgggttctcttacaacgagctcctggacggc
tacaagtgcgacgggtgtagcaggatgaacactaccagctcaacggtgcgactggcccgg
ctacccaagctcctgtgtatctctcttagccggttcagtgtcgacaggggagataccaga
aaaaacaacaccaaggtcgttttcccccttgacgatttgaatcttgcggctgtatcagat
ccaacgcccagtggggagggaataggcgaagagtggactggccctttccgctactattgc
tatgcggccgttcttcatggggggactttgcgatctggccactatacagcatttgtgaga
gaccagaacccgtccaggaacggcggcgtttggtaccactgtaacgattcgatcatttca
accaagaccatcagaaacgaggaggatgctgacgcagcaggcatgtatgctgcggactcg
gaatcttcagcctacattctgttctacagtcgtcagcccgtggcgaagtaa

DBGET integrated database retrieval system