KEGG   Magnaporthe oryzae: MGG_04988Help
Entry
MGG_04988         CDS       T01027                                 

Definition
chromosome segregation protein sudA
Orthology
K06669  
structural maintenance of chromosome 3 (chondroitin sulfate proteoglycan 6)
Organism
mgr  Magnaporthe oryzae
Pathway
Cell cycle - yeast
Meiosis - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:mgr04111]
Cellular Processes; Cell growth and death; Meiosis - yeast [PATH:mgr04113]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1204 aa AA seqDB search
MYIKQIIIQGFKSYKEQTVIEPFSPGTNVIVGRNGSGKSNFFAAIRFVLSDAYTQMSREE
RQALLHEGSGSAVMTAYVEVIFDNSDDRFHTGNKEVSIKRTISLKKDEYSIDKKVVQSKN
EVFSMLEMAGFSRVNPYYIVPQGRVTALTNMKEADRLKLLKEIAGTESYEARRTESRKIM
HETINKREKIDELLKDVKERLQELEEEKEELRGFQAKDRERRCLEYAYYHHHQQVLTEAL
EEIEQARLSADGNSEYQTRFAEGEKSIAQLESTLEELQQSLEMLRIDRQQLENDRRATSK
ALAKVELKVKDLEQAQSTQTQSKKQHDAELKNVRAEIKTKEAELATVIPEYNKRKQKEDA
IRQQYDSAEATRQRLLDKQSRGARFKNKAERDKFLRREIQELGTSLNALKANRMELQEST
VSTAIAIQTLEAEIAQLQQDLQTRGTRKEALNKQLMDAMNKENAMQDEKLELRREADKLE
ARIATARRQREKADHRLGQAMDSATSRALDKIARLKRERNIPGAYGILADLMQVDDIYRV
PVEQVAGNSLFHYVVDNKETGTMILDLLEKEKSGRVTLMPLAQLRPRKVNMPRAQNAFPL
IDKLQYDEVYDKAFQQVFGKSVLCQSRDVATQYSRTHNVDCVTMDGDTTSKRGAVSGGYT
DPTASRLLALREANKLREEYYELQEELQRLHKQIELKSQETTTAVGLVRKLEQEMHKLDM
EFRVKDAEFASKRKELQGLRKQLDNINVDLEKVDKEMKDMNETLSSYEAEAASEFKKALS
SQEEEQLEVLGAQLGELGTQLADCSRRRLELERRKLMLENELNNNLRRREDELMSMAFDT
SSGASSFAGPVGSVDEAKKELAKLKKRAAHLDSELRKAETEADRVTAQIVELENRKAHRE
QEQQELAREIEKMQKKLEKGLSKKAIIANKLAEFTKNIRDLGVLPEEAFDKYESMEMKSI
EKRLSKVNEALKKYKHVNKKAFEQYNSFTTQQEQLVKRRKELDSSQQSIEDLISHLDQKK
DEAIERTFKQVSREFATIFERLVPAGHGRLVIQRRADRRQTAAEESEDDQRRGTIENYTG
VGISVSFNSKEFDEQQKIQQLSGGQKSLCALCLIFAIQQTESSPMVVFDEVDANLDAQYR
TAVASLLQSISSEAGTQFICTTFRPEIVLVADKCYGVTFTNKTSSIDCVPTEAALDFVEG
QQKR
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgtacatcaagcagatcatcatccagggcttcaagagctacaaggagcagaccgtcatc
gagcccttctcgcccggtaccaatgtcatcgtcggtcgaaacggatcgggtaagagcaac
ttcttcgccgccattcggttcgtcctcagcgatgcctacacccagatgagccgcgaggaa
cgccaggccctcctccacgagggttctggctccgcggtcatgacggcatacgtcgaggtc
atattcgacaacagcgacgatcggttccacacaggcaacaaagaggtcagcatcaagcgg
acaatcagcctcaagaaagacgaatactcaatcgacaaaaaggtcgtccagtccaagaac
gaagtcttcagcatgctcgagatggccggtttctcccgcgtgaacccgtactacattgtg
cctcagggtcgtgtcaccgcgctgaccaacatgaaggaggccgaccgtctcaagctgctc
aaggaaattgccggaactgagagctatgaggcgcgccgaactgagtctcgcaaaatcatg
catgagaccatcaacaagcgggagaagattgatgagctgctcaaggatgtcaaggaacgt
ttgcaggagctcgaggaggaaaaggaggagctgcgcggcttccaggcaaaggatcgtgag
cgaaggtgtctcgagtacgcttactaccaccatcatcaacaggtgcttaccgaagccctg
gaggagatcgagcaagctcgtttgagtgccgacggcaacagcgaataccagacaaggttt
gcagagggtgagaagagcatagctcaactcgagtccacactagaggagcttcagcagtcg
ctcgagatgctacgcattgacagacaacaactcgaaaatgaccgtcgcgcaacatccaaa
gctctagccaaggtggaactcaaggtcaaggatctcgagcaggctcagagcactcagaca
caaagcaaaaaacagcacgatgcagagctcaagaatgttcgggcagaaataaaaaccaaa
gaggccgagcttgcaacagttattcctgaatacaacaagagaaaacaaaaggaagatgcc
ataaggcaacaatatgactcagcagaggcaacgcgccaaagactcctagacaaacagtcc
cgtggcgcccggtttaagaataaggccgaacgcgacaagttcttgcgcagggagattcag
gagctcggcacaagtctcaacgccctaaaggcaaaccgtatggagttacaagagagtaca
gtatcaacagcaatcgcaatccagactttggaggcggaaattgcgcaattgcaacaagat
ctccagactcggggtacacgcaaagaagccttgaacaaacaattaatggacgccatgaac
aaggaaaatgccatgcaagacgaaaagttggaactgaggcgagaagcagacaagttggag
gcgaggatcgccaccgcaaggagacaaagggagaaggcagatcacaggcttggccaggcc
atggattctgcaacatcccgtgcattggacaagattgctcgtttgaagcgggaacgaaat
attcccggcgcctacggcattctcgctgatctcatgcaagtcgatgacatataccgcgtc
ccagtcgagcaagtggctggcaatagtttgtttcactatgttgtggacaacaaggagaca
ggtactatgattcttgatcttctcgagaaggagaagtcggggcgtgtcaccctcatgcct
ctggcccaacttcgtccgagaaaagtgaacatgccccgcgcgcagaatgcgtttcccttg
atcgacaagctccagtacgatgaggtgtacgacaaggctttccagcaggtctttggcaaa
agcgtcctgtgtcaatctcgtgatgttgccacgcagtattcacgaactcacaatgtcgat
tgcgttacgatggatggtgataccacgtccaagaggggcgcggtcagtggtggatatact
gatccgactgcatctcgattgcttgctctgcgggaggcaaacaagctcagggaagagtac
tacgaacttcaagaggagctccagagactccacaagcaaatagagctgaaatcacaagaa
acaaccactgctgtgggtcttgtgcgcaagctcgagcaggaaatgcacaaactcgacatg
gagttcagagtcaaggatgctgaattcgcgagcaagcggaaagagcttcaaggacttagg
aagcagctggacaacatcaatgtggacctcgagaaggtcgataaggagatgaaggatatg
aatgagaccctctcaagctacgaggccgaggcggcctcggaatttaaaaaggccttgtct
tcgcaagaagaagagcagcttgaggtacttggtgctcaactgggtgagctcggtacgcaa
ctcgccgactgcagcaggcggcgcctcgagttggagaggcgtaagcttatgttggagaac
gagctcaacaacaaccttcgtcgcagagaggacgagctcatgagcatggcgtttgacaca
tccagcggtgctagcagcttcgcgggacccgtcggcagcgttgacgaagctaagaaggag
cttgccaagctcaaaaagagggccgcacatcttgattctgaacttcgcaaggcggagacg
gaagcggacagggtcacagcacagattgtcgagctggagaaccgcaaggctcacagagag
caagaacagcaagagctagctcgcgagatcgagaagatgcagaaaaagctggaaaagggt
ctgtcaaagaaggccatcatcgccaacaaacttgccgagttcacgaaaaacattcgcgat
ctgggcgtcttgccggaggaagctttcgataagtacgagagcatggagatgaagagtatc
gagaagaggctcagcaaggtcaatgaggccctgaagaagtacaagcacgtcaacaaaaag
gcattcgagcagtacaacagtttcacgacacagcaggaacaactagtcaagcgccgcaaa
gagcttgattcttcccagcagtcgatcgaagatctgatcagtcatttggaccagaagaag
gatgaggccatcgagcgtacgttcaaacaggtgtcgcgtgagttcgccaccattttcgag
cgtctagtcccggctggtcatggtcgcctggtcatccagcgccgggcggaccgacgtcag
actgccgccgaagagtcggaagacgatcagaggcgcggcaccatcgaaaactacactggt
gtcggaatcagcgtgtctttcaactcgaaagagtttgacgaacagcaaaagatccaacag
ctcagtggtgggcaaaagagtttgtgtgctttgtgcctcatctttgccatccagcagacc
gagtcgagccccatggtggtcttcgacgaggttgacgccaacctggacgcccagtaccgt
accgcagtggccagcctgctgcagtcgatctcgtccgaggccggcacgcagttcatctgc
accaccttccgtcccgagatcgtcctcgttgccgacaaatgctatggagtcactttcacc
aacaagaccagctccatcgattgcgtgccgacggaggcggcgctggactttgtcgagggc
cagcagaagaggtag

DBGET integrated database retrieval system