KEGG   Magnaporthe oryzae: MGG_05008Help
Entry
MGG_05008         CDS       T01027                                 

Definition
aldehyde dehydrogenase
Orthology
K00129  
aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
beta-Alanine metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgr00010]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mgr00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mgr00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mgr00360]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mgr00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 550 aa AA seqDB search
MSPRASRSLSRALFSVCASFESRVGSPPVQRVLKNPAILYRQLSHSTTALGLKMNIQLSA
PNGKKWIQPTGLFINNEFVKSSNGQKLTTVNAATEEDITSVYSATEEDIDKAVKAARAAF
KHPSWRNLSGTERGEMMHKLADLVVKNAETLATIEALDGGKPYSVALGEDVVEFEKTIRY
YAGFADKNFGQTIDVGPNKFAYTIKEPIGVCGQIIPWNYPLCMAAWKLGPALACGNTVVL
KLAEQTPLSMLYVATLIKEAGFPAGVVNVINGLGGEAGAAIVQHPDIDKVAFTGSTATGK
QIMKACAGTMKNITLETGGKSPLLVFDDADLDLAAEWSHIGIMSNQGQICTATSRILVHE
SVYDKFVGRFKDTVEKVSIVGDPFDEKTFQGPQVTKAQYEKVLGYIKLAQEEGATIATGG
KPAPQNGKGFYVAPTVFTNVKTSMRVYKEEIFGPCVSIISFKDEEEAVELANDTTYGLGA
AVFTRNLTRAHRVAREIQSGMVWINSSNDSDCRVPFGGVKQSGIGRELGEAGLASYCNIK
SVHVNMAAHL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctcgggccagtcgctcgcttagtcgtgctctcttttctgtttgtgcatctttt
gagtcaagagtcggcagtccaccagtacaaagagtcttgaagaatccagctatcttatat
cgtcaactatcacactcgacaacagctcttgggctcaaaatgaatattcaactttccgcc
cccaacggcaagaaatggattcaacccacgggtctttttatcaacaatgaattcgtcaag
agcagcaatggccagaaattgaccaccgtcaacgctgccaccgaggaggatattacctcg
gtctattccgccaccgaagaggacattgataaggccgtcaaggccgcacgtgctgctttc
aagcacccatcatggaggaacctttccggaactgagcgtggcgagatgatgcacaagctt
gctgaccttgttgtcaagaatgctgaaaccttggccaccattgaggctctcgacggcggc
aagccctactctgtcgcccttggtgaggacgttgtcgagtttgaaaagaccatacgatat
tatgctggttttgcagacaagaactttggccagaccatcgacgtcggcccaaacaagttt
gcgtacaccatcaaggagcccattggtgtctgcggccagatcattccctggaactatccc
ctttgtatggccgcctggaagctcggccctgcgcttgcttgcggcaacacggtcgtgctc
aagcttgctgaacagactccattgtcgatgctctacgttgcaaccttgatcaaggaggcc
gggtttcctgcaggcgtagtcaatgttatcaacggccttggcggcgaggctggggcagcc
attgtgcagcacccagatatcgacaaggttgcctttaccggaagcacagcaactggcaag
caaatcatgaaggcatgcgcaggaacaatgaagaacatcacactcgagacgggcggcaag
tcaccactacttgtttttgacgacgccgacctcgacctggccgccgagtggtctcacatt
ggcatcatgagcaaccagggacagatctgtaccgcgacatctcgtattctggtacacgag
tccgtctatgacaaattcgtcggtcgtttcaaggacaccgtcgaaaaggtgtcaatagta
ggggatccctttgacgaaaagaccttccagggaccacaggtgaccaaggcacagtacgaa
aaggtcctgggttatatcaagttggcacaagaagagggtgccaccattgctactggtggc
aagccagccccgcaaaacggtaagggtttctacgtcgcccctaccgtgtttaccaacgtc
aagacgtcgatgagggtctacaaggaggagatctttggaccatgcgtatccatcatctcg
ttcaaggacgaggaggaggcggtcgagttggccaacgacaccacctatggtttgggcgcc
gcagtctttactcgcaacctcaccagggcgcaccgggtcgcccgcgaaatccagtcgggt
atggtttggatcaacagcagcaacgactccgactgccgtgttccttttggtggcgtcaag
cagtctggtattggtcgcgaattgggtgaggctggccttgcctcttattgcaacatcaag
agcgtacacgtgaacatggctgcgcatttgtag

DBGET integrated database retrieval system