KEGG   Magnaporthe oryzae: MGG_05008Help
Entry
MGG_05008         CDS       T01027                                 

Definition
aldehyde dehydrogenase
Orthology
K00129  
aldehyde dehydrogenase (NAD(P)+) [EC:1.2.1.5]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycolysis / Gluconeogenesis
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
beta-Alanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MGG_05008
  Amino acid metabolism
   00340 Histidine metabolism
    MGG_05008
   00350 Tyrosine metabolism
    MGG_05008
   00360 Phenylalanine metabolism
    MGG_05008
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MGG_05008
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.5  aldehyde dehydrogenase [NAD(P)+]
     MGG_05008
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 550 aa AA seqDB search
MSPRASRSLSRALFSVCASFESRVGSPPVQRVLKNPAILYRQLSHSTTALGLKMNIQLSA
PNGKKWIQPTGLFINNEFVKSSNGQKLTTVNAATEEDITSVYSATEEDIDKAVKAARAAF
KHPSWRNLSGTERGEMMHKLADLVVKNAETLATIEALDGGKPYSVALGEDVVEFEKTIRY
YAGFADKNFGQTIDVGPNKFAYTIKEPIGVCGQIIPWNYPLCMAAWKLGPALACGNTVVL
KLAEQTPLSMLYVATLIKEAGFPAGVVNVINGLGGEAGAAIVQHPDIDKVAFTGSTATGK
QIMKACAGTMKNITLETGGKSPLLVFDDADLDLAAEWSHIGIMSNQGQICTATSRILVHE
SVYDKFVGRFKDTVEKVSIVGDPFDEKTFQGPQVTKAQYEKVLGYIKLAQEEGATIATGG
KPAPQNGKGFYVAPTVFTNVKTSMRVYKEEIFGPCVSIISFKDEEEAVELANDTTYGLGA
AVFTRNLTRAHRVAREIQSGMVWINSSNDSDCRVPFGGVKQSGIGRELGEAGLASYCNIK
SVHVNMAAHL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcctcgggccagtcgctcgcttagtcgtgctctcttttctgtttgtgcatctttt
gagtcaagagtcggcagtccaccagtacaaagagtcttgaagaatccagctatcttatat
cgtcaactatcacactcgacaacagctcttgggctcaaaatgaatattcaactttccgcc
cccaacggcaagaaatggattcaacccacgggtctttttatcaacaatgaattcgtcaag
agcagcaatggccagaaattgaccaccgtcaacgctgccaccgaggaggatattacctcg
gtctattccgccaccgaagaggacattgataaggccgtcaaggccgcacgtgctgctttc
aagcacccatcatggaggaacctttccggaactgagcgtggcgagatgatgcacaagctt
gctgaccttgttgtcaagaatgctgaaaccttggccaccattgaggctctcgacggcggc
aagccctactctgtcgcccttggtgaggacgttgtcgagtttgaaaagaccatacgatat
tatgctggttttgcagacaagaactttggccagaccatcgacgtcggcccaaacaagttt
gcgtacaccatcaaggagcccattggtgtctgcggccagatcattccctggaactatccc
ctttgtatggccgcctggaagctcggccctgcgcttgcttgcggcaacacggtcgtgctc
aagcttgctgaacagactccattgtcgatgctctacgttgcaaccttgatcaaggaggcc
gggtttcctgcaggcgtagtcaatgttatcaacggccttggcggcgaggctggggcagcc
attgtgcagcacccagatatcgacaaggttgcctttaccggaagcacagcaactggcaag
caaatcatgaaggcatgcgcaggaacaatgaagaacatcacactcgagacgggcggcaag
tcaccactacttgtttttgacgacgccgacctcgacctggccgccgagtggtctcacatt
ggcatcatgagcaaccagggacagatctgtaccgcgacatctcgtattctggtacacgag
tccgtctatgacaaattcgtcggtcgtttcaaggacaccgtcgaaaaggtgtcaatagta
ggggatccctttgacgaaaagaccttccagggaccacaggtgaccaaggcacagtacgaa
aaggtcctgggttatatcaagttggcacaagaagagggtgccaccattgctactggtggc
aagccagccccgcaaaacggtaagggtttctacgtcgcccctaccgtgtttaccaacgtc
aagacgtcgatgagggtctacaaggaggagatctttggaccatgcgtatccatcatctcg
ttcaaggacgaggaggaggcggtcgagttggccaacgacaccacctatggtttgggcgcc
gcagtctttactcgcaacctcaccagggcgcaccgggtcgcccgcgaaatccagtcgggt
atggtttggatcaacagcagcaacgactccgactgccgtgttccttttggtggcgtcaag
cagtctggtattggtcgcgaattgggtgaggctggccttgcctcttattgcaacatcaag
agcgtacacgtgaacatggctgcgcatttgtag

DBGET integrated database retrieval system