KEGG   Magnaporthe oryzae: MGG_05134Help
Entry
MGG_05134         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
mgr  Magnaporthe oryzae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    MGG_05134
Translation factors [BR:mgr03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    MGG_05134
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 335 aa AA seqDB search
MFAVYALFFNPKSHFLSHHLFKPLLPLQPRFAFILLRRNSPSRSDLDQLSASKHISQINI
IKMPTKKWEDEESSSGSSDESSPAVAVSVPRRKFDDEEANDSDVLDSWDAAEDSEVEREK
AKKAAEAKAKAEAEAKANKKTKAARINEHKQRRKEAEESDESDDETESQRRERLRRTEKE
ADLAHAEDLFGDIGVPAGRKVKAASTSVSIDPSDPSKTVELSDMPIFNPKTKTQFEDMRQ
ALIPLITASSGRKPHYNNFMEEFVRQLCADMPSENIKKISSKLTALSNEKMKQEKAAAGT
KKTKAAKTKTSLVANRAGVTDTNSYEDTFGDDDFM
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgtttacgcgctatttttcaaccccaaatcacatttcctttcacaccatctc
ttcaagcccctcttgcctttacaacctcgtttcgcttttattttattgcggcgcaacagc
ccgtcaagatccgatctcgatcagttatcagcctcgaaacatatttcacaaatcaacatc
atcaaaatgccaacaaagaagtgggaagatgaggagtcctcctccggcagctccgacgag
tcctcccccgcggttgccgtctcagtcccccgccgcaagttcgatgacgaggaggccaac
gacagcgatgtcctcgactcgtgggatgccgccgaagactcggaggtagagcgcgaaaag
gcaaagaaggccgcagaggccaaggccaaggccgaagccgaagccaaggccaacaagaag
accaaggccgcccgtatcaacgagcacaagcagcgtcgcaaggaggccgaggagtcggac
gagagtgacgacgagaccgagtcgcagcgccgcgagcgcctccgtcgcaccgagaaggag
gccgatctcgcccacgccgaggacctgtttggtgacattggtgtgcccgcgggccgcaag
gtcaaggccgccagcaccagcgtcagcatcgacccgtcggacccttccaagacggttgag
ctgtccgacatgcccatcttcaaccccaagaccaagacgcagtttgaggacatgcgccag
gccctgatcccgctcatcacggccagctctggcaggaagccgcactacaacaactttatg
gaggagtttgtcaggcagctgtgcgccgacatgccctcggagaacatcaagaagatctcg
agcaagctcacggccctcagcaacgaaaagatgaagcaggagaaggccgccgccggaacc
aagaagaccaaggccgccaagacaaagacctcgctggtcgctaacagggctggcgtgact
gacaccaactcgtatgaggatactttcggagacgacgactttatgtga

DBGET integrated database retrieval system