KEGG   Magnaporthe oryzae: MGG_05147Help
Entry
MGG_05147         CDS       T01027                                 

Definition
sphingoid long chain base kinase 4
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
mgr  Magnaporthe oryzae
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    MGG_05147
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     MGG_05147
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 533 aa AA seqDB search
MALDGESLALGSYNLSIVGDKLLVNDKSSTGKSKSSRSCFGTGNSATKQSQRTIPLYNIL
WAEVAGDSLVIDYAEDVSKTKIRPTKITIPLPPATTAKDTTTDAPATAEAGADLEAGNAG
AQSSPAARASAWASSLLDHSYDPSTTRRKRAFVIINPHAGPGGAMRKFETQVRPIFLAAR
MELEIVTTTRRGEAEEIVQKLDLDKYDVIAVASGDGLVYETFNGLGRRPDAQKALKSVAV
VHIPCGSGNAMACNLYGTHRVSPAALAAVKGVPTALDLVSVTQGNTRTLSFLSQALGVIA
ESDLGTDNLRWMGSARFTYGYITRAVKRAVYPCDISVKVEIDDKAGIKEHYARHRPDRSS
TAPVTKADSVVDGDVGTEVGEGLPPLKYGTINDKVPEGWETFSYDNMGQLYCGNMAYIMP
DSNIFSAACINDGMMDLVTVDGDISPFKSLELMTLVESGKFFDDSRVRYRKVSAYRITPR
NQASGYISIDGEGVPFAPFQCEIHRGLGLVLSKAGTYEAPGPMNWEKVAVNKS
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggacggggaatcgcttgctcttggcagctacaatctctcaatcgtgggagac
aagctgctcgtgaacgacaagtcctccactggcaaatcaaaatcaagcagatcttgcttc
ggcactggcaattccgccacaaaacaaagccaacgtaccataccactatacaatatcctc
tgggccgaggtagctggcgatagtctggttatagactatgctgaggacgtttccaagacg
aaaatacgccccaccaagataaccatacctctgccaccggcgacgacagcaaaggatacc
accaccgatgctccggcaacagcagaagctggcgccgacctagaagctggcaatgccggc
gcgcaatcctccccagccgcccgggcatctgcctgggcgtcatctctcctcgaccatagt
tatgacccctctaccacgcggcggaaacgagcattcgtgataatcaacccgcacgcaggc
cccggcggcgcaatgcgcaagttcgagacccaagtacgccccatattcctcgcagcccgc
atggagctcgagatcgtcacgacaacacggaggggggaggcggaggagattgtgcaaaag
ctggatctcgacaagtacgacgtcatcgcggttgcgtccggcgatggactggtgtacgag
acgttcaacgggctcggcagacggccggacgctcaaaaggccctcaagagcgtcgccgtg
gtgcacataccgtgcgggagcggcaacgccatggcttgcaacctctacggcacacatagg
gtgtctcctgctgctctggctgcagtcaagggcgtgccgacggctttggatctcgtcagc
gtcacgcagggcaacacgcgaaccctcagcttcctgagccaggcgttgggtgtcattgca
gagtctgacctggggacagacaacctgcggtggatgggttctgcacgttttacgtatggc
tacatcacgcgcgcggtgaagcgagccgtttatccttgcgacatctccgtcaaggtggag
attgatgataaagccgggattaaagagcactacgccagacaccgcccggacagatcctcc
acggccccggtcacaaaggcagactctgttgtcgatggcgatgttggaaccgaggttggg
gagggtctacctcccttgaagtacggcacaatcaacgataaagttcctgagggctgggaa
acattctcatacgacaatatgggacagctttactgcggaaacatggcctacatcatgccc
gatagcaacatattctccgcagcctgcatcaacgacggtatgatggacctcgtgacggtc
gacggcgacatctcgccgttcaagtcgttggagctgatgacgctcgtcgagagcggcaag
ttctttgatgactctcgcgtcaggtaccgcaaggtttcagcctatcgcatcactcctcgc
aaccaggcaagcggctacatcagcatcgatggtgagggcgtgccgtttgccccttttcaa
tgtgaaattcaccgaggtctcggcctagttctatccaaggccggcacctacgaggcccct
ggcccaatgaactgggagaaggtcgcggtgaacaagtcctag

DBGET integrated database retrieval system