KEGG   Magnaporthe oryzae: MGG_05283Help
Entry
MGG_05283         CDS       T01027                                 

Definition
uricase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
mgr  Magnaporthe oryzae
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MGG_05283
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    MGG_05283
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     MGG_05283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 295 aa AA seqDB search
MPSLSAARYGKDNVRVYKVHRNAETGQQSVTEMTVCCLLEGEIDASFTKADNSVVVATDS
IKNTIYIKARETPVNPPELYASILGQHFIDTYPHIHTAHVDVIVHRWTRMTIDGQPHPHS
FFRDGQETRTVGAVVRRGSGLALRSGIAGLSVLKSTGSAFHGFVRDEFTTLPETWDRILS
TDVDCGWSWKSFPDLDAVKAIVPKFDQAWEDARSITMKTFATDDSASVQATMYKMCEQIL
EAAPEVEKTDYSLPNKHYFEVDLSWHKGLANTGKDAEVYVPQSGPNGLIKCEVSR
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccttcactatctgcagcccggtacggcaaggacaatgtccgcgtctacaaggttcac
aggaatgcagagacgggacagcagagcgtcacagagatgaccgtatgctgcctgctggag
ggcgagatcgacgcatccttcacaaaggccgacaacagcgtggtcgttgccaccgattcc
atcaagaacaccatctacatcaaggcccgggaaacccccgtgaatcctccggagctctac
gcctccattctgggccagcactttatcgacacgtacccgcacattcacacggcccacgtc
gacgtgatcgtgcaccgctggacccgcatgactatcgacggccagccgcacccgcactcc
ttctttcgggacgggcaggagacccgcaccgtcggcgccgtggtccgccgcggctctggc
ctcgccctccggagcggcatcgcgggtctgtcggtgctcaagagcacgggctcggccttc
cacggcttcgtgcgcgacgagttcaccaccctgcccgagacgtgggaccgcatcctctcg
accgacgtcgactgcggctggtcgtggaagtccttcccggacctcgacgccgtcaaggcc
atcgtgcccaagttcgaccaggcctgggaggacgccaggtccatcaccatgaagacgttt
gctactgacgatagcgcctcggtccaggccaccatgtacaagatgtgtgagcagatcctc
gaggctgcacccgaggtcgagaagacggactactcgctgccaaacaagcactactttgaa
gttgacctcagttggcacaagggtctggcaaacacaggaaaggatgccgaggtttacgtg
cctcagtcggggcccaatggtctcatcaagtgcgaggttagccgctaa

DBGET integrated database retrieval system