KEGG   Magnaporthe oryzae: MGG_05464Help
Entry
MGG_05464         CDS       T01027                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     MGG_05464
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 405 aa AA seqDB search
MTRLATLITLAGLLAVSPGAYAQRNRNDTGGSTGAEGLNSLAVKAGLLYFGTASDTRNFA
DEPYMSVVNNTNEFGMIVPENSMKWEATEKEPGRFSFANADRVRALTKANGQMLRCHALT
WHSQLPNFVKTTAWTRDTLTAAIESHISNEVGHFAGDCYAWDVVNEAVNENGSFRDSPFH
RTLGTDFLAISFRAAAAADPNAKLYYNDFNIETPGPKANAAMGIVRLLKEQGVRIDGVGF
QGHLTVGSTPSRAQLASQLQRFADLGVEVTYTELDIRHKSLPVSSRAAQDQARDYVSVIG
SCLDVTACVGVMVWQPTDKYSWIPETFPGTGDACLFDANMNPKPAYTSVSSLLAAAAATA
PASVVPPASVTTSKTPIQAGAGRETVSIAGLTLALSSLAFGMFML
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacaagactagcaacactcatcaccctcgcaggcctcttggccgtttcacctggggcg
tatgcacagagaaacagaaacgatacgggtggcagcaccggcgcagaaggcctaaattca
ctagccgtcaaggccggcttgctctactttggcacagcaagtgacaccaggaactttgcc
gacgagccctacatgagcgtcgtcaacaacaccaacgagtttggcatgatcgtcccggag
aactcaatgaagtgggaggccaccgaaaaggagcccggccgcttctcgttcgccaatgca
gaccgcgtccgcgccctgaccaaggccaacgggcagatgctccgctgccacgccctgacg
tggcactcgcagctcccaaactttgtcaagacgaccgcctggaccagggacaccctcacc
gccgccatcgagtcccacatctccaatgaggttggccactttgcgggtgattgctacgcc
tgggatgtagtcaacgaagccgtcaacgagaatggctccttccgcgactcgcccttccat
cgcaccctcggcaccgatttcctcgccatttctttccgcgccgccgccgccgccgacccg
aacgccaagctgtactacaatgactttaacatcgaaaccccggggcccaaggccaacgcc
gccatgggcattgtgcgcctgctcaaggaacagggcgtccgcatcgacggggtcggcttc
cagggccacctgacagtcggcagcaccccgagcagggcccagctcgcctcgcagctccag
cgcttcgccgacctcggggtcgaggtcacttataccgagctcgatatccgacacaaatcc
ctgccggtgagcagccgcgccgcgcaggaccaggcccgcgactacgtgtccgtcatcggc
tcgtgcctcgacgtcaccgcctgcgtcggcgtcatggtttggcagcccaccgacaagtac
agctggatcccggagaccttccctggcacgggcgacgcctgcctgtttgacgcgaacatg
aatcccaagccggcctacactagtgtgtcgagcctcctggctgctgctgctgcaacggcg
cctgcaagcgtcgtgcccccagctagcgttacgacgtccaagaccccgatccaggcggga
gctggtcgggagaccgtttcgatcgcaggtctgacactggccttgagctcgttggccttt
ggcatgtttatgctctga

  All links  
No link information was found.   
DBGET integrated database retrieval system