KEGG   Magnaporthe oryzae: MGG_05481Help
Entry
MGG_05481         CDS       T01027                                 

Definition
elongator complex protein 3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     MGG_05481
Transfer RNA biogenesis [BR:mgr03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    MGG_05481
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 569 aa AA seqDB search
MSTTTVARPAASATLAPEGERFLRCCADIANALIEDYEAAARDPKHRQKDVNLNSLRGKF
SRKHKLKKIPPLTAIIAAVPEHYKKYILPKLIAKPIRTSSGIAVVAVMCKPHRCPHIAYT
GNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKALGHSVDKV
EYIIMGGTFMSLPESYRDDFISQLHNALSGYQTSNVDEAVEAGEMSNVKCVGITIETRPD
YCLQPHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVVSHM
MPDLPNVGMERDVDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYQNYTPNGL
IDLVARILALVPPWTRIYRVQRDIPMPLVSSGVENGNLRELALARMKDFGTTCRDVRTRE
VGINEVKHKIRPNQVELVRRDYVANGGWETFLAYEDPKQDILIGLLRLRKCTEKYTFREE
LTGQPTSLVRELHVYGTAVPVHARDPKKFQHQGFGTLLMEEAERIARDEHGSEKISVISG
VGVRSYYKKLGYWLDGPYMSKWLDGRPGN
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccactaccgtggcgaggcctgcagcctctgccactcttgcaccagaaggcgaa
cggtttctaagatgctgcgccgatattgcaaatgcgctcattgaagactacgaggcggct
gcgcgagacccaaaacaccggcaaaaagatgtgaacctgaacagtctgcgaggcaaattc
tcccgcaagcacaagttgaagaagatcccacctttgactgcaatcatagccgcggtcccc
gagcattacaaaaagtacatcctgccaaagctcattgcgaagccgattcgaacgtcttct
ggtattgctgttgttgctgtcatgtgcaaaccgcatcgatgcccccacatcgcatacacg
ggcaacatctgcgtttactgcccaggtggtcccgattcagactttgagtacagcacacaa
tcatacactggttatgagccaacttcaatgcgagccatccgtgcccgctacgacccattt
gagcaggccaggggtcgtgtggatcagctaaaggctctgggacactcggtggacaaggtt
gagtacatcatcatgggcggtaccttcatgtcactaccagagtcatacagggatgacttt
atctcgcaactacacaatgctctgagcggttatcagacgtcaaacgtcgatgaggccgtc
gaggctggcgagatgagcaatgtcaagtgcgttggcatcacgatagagaccaggcccgac
tactgtttacagccacacttgtctagcatgttgaggtacggctgcacacggttggaaata
ggagtgcagtcattgtacgaggatgtggcgcgcgataccaacagaggtcacacggtagca
gcagttgcggagaccttttgcctggccaaggacgccggcttcaaggtcgtgagccacatg
atgcccgacttgccaaacgtcggcatggagcgagatgtggatcagttccgagagtacttt
gaaaacccagccttcagaacggatggtctgaagatctacccgacgctagtcatccgcggt
accggtctttacgaactctggaggacaggacgataccaaaattacacacccaatgggctt
atcgacctagtggctcggattctcgccctggttccaccgtggacgcgcatttaccgtgtc
cagcgtgatattcccatgccgctcgtcagctcgggtgtagagaacggcaacctgcgggag
ttggctctggcgcgtatgaaagactttggtacaacatgccgtgatgtcagaacgagggag
gtcggcatcaacgaggtcaagcacaagatacggccaaaccaggtcgagctcgtgcgccgt
gactacgttgccaacggcggctgggagacattcttggcatacgaggaccctaagcaggac
attcttattggcctgttgcggttgcgtaaatgcactgaaaagtacactttccgcgaagaa
ctcacgggtcagccaacaagtttggtgcgggagctgcacgtctatggtaccgcggtgcct
gtgcacgcccgagaccccaagaagttccagcatcagggtttcggcactctgctgatggaa
gaggcagagcgtattgcccgtgacgagcacggcagtgaaaagataagtgtcatttcgggt
gtcggtgtccgcagttactacaagaaactgggatactggctcgacgggccatatatgagt
aaatggcttgatgggaggccgggtaattag

DBGET integrated database retrieval system