KEGG   Magnaporthe oryzae: MGG_05753Help
Entry
MGG_05753         CDS       T01027                                 

Definition
protein disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MGG_05753
Enzymes [BR:mgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MGG_05753
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MGG_05753
  Exosomal proteins of colorectal cancer cells
   MGG_05753
  Exosomal proteins of bladder cancer cells
   MGG_05753
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 510 aa AA seqDB search
MHTVRSFALGLLATAAVVSASDAPSDVVQLKEDTFDAFIKENDLVLAEFFAPWCGHCKAL
APHYEKAATSLKEKNIKLIKVDCTEEQDLCQKHGVEGYPTLKVFRGLDNVVPYKGQRQDD
GIISYMVKQSLPAVSTITTDSLEEFKKTDKVVVVAYLSSDDKTSTETFTQAAEKLRDHYP
FGSSTDAALAEAEGVKAPAIVVYKTFDEGKAVFDKKFDVEEIEKFAKTAATPLIGEVGPE
TYSDYMSAGIPLAYIFAETAEERTTLSEALKSIAEKHRGAINFATIDAKAFGAHAGNLNL
KADKFPAFAIQETVKNQKFPFDQDKEITAEAISKFVEDFVAGKIEPSVKSEPIPETNDGP
VSVVVAHTYNDIVLDDTKDVLIEFYAPWCGHCKALAPKYEELGALYQKSEFKDKVVIAKV
DATANDVPDEIQGFPTIKLYAAGKKDSPATYSGSRTIEDLITFVKENGKYKAEVSVEAEK
ETPVAPAATESEEAKATEAAEKKKDEHDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcataccgtcaggagtttcgccttgggccttttggccaccgccgccgtggtatcggct
tcagatgctccctcagatgttgtccaactgaaggaggacaccttcgacgcattcatcaag
gagaacgacctcgtccttgccgagttctttgcgccgtggtgcggtcactgcaaggctctc
gccccccactatgagaaggccgccacctctctcaaggagaagaacatcaagcttatcaag
gtcgactgcacagaggagcaggatctgtgccaaaaacacggtgtcgagggctaccccacc
ctgaaggtcttccgtggccttgacaacgtcgtgccctacaagggtcagaggcaggatgat
ggaattatctcgtatatggtcaagcagtctctgcctgctgtttcgaccatcaccaccgac
agcctcgaggagttcaagaagaccgacaaggttgtcgttgtcgcttacttgtccagcgac
gacaagacctcgactgagactttcacccaggctgccgagaagctccgtgaccactacccc
ttcggttccagcaccgatgccgcccttgcagaggctgagggtgtcaaggctcctgccatt
gttgtttacaagacctttgatgagggcaaggctgtcttcgacaagaaatttgacgtcgag
gagattgagaagttcgccaagaccgccgccactcctttgatcggcgaggtcggccccgag
acatactccgactacatgtccgctggcattcctctggcgtacatcttcgccgagaccgct
gaggagcgtactactctcagcgaggccctcaagtccatcgccgagaagcaccgtggcgcc
atcaacttcgccactatcgatgctaaggcttttggcgcccacgctggtaacctgaacctc
aaggccgacaagttccccgccttcgccatccaggagactgtcaagaaccagaagttcccc
ttcgaccaggacaaggagatcaccgccgaggctatctccaagttcgtcgaggacttcgtt
gctggcaagatcgagcccagcgtcaagtccgagcctattcccgagaccaacgatggccct
gtcagcgttgtcgttgcccacacctacaacgacatcgttctcgacgacaccaaggacgtt
ctcatcgagttctacgccccttggtgcggtcattgcaaggctttggctcccaagtacgag
gagcttggtgctctctaccagaagtctgagttcaaggacaaggtcgtcatcgccaaggtt
gacgccactgccaacgacgttcccgacgagatccagggtttccccaccatcaagctctac
gctgctggcaagaaggactcgcccgctacctacagcggctcgcgcactatcgaggacttg
atcactttcgtcaaggagaacggcaagtacaaggctgaggtttccgttgaggccgagaag
gagaccccggttgccccggctgctactgagtctgaggaggccaaggccactgaggctgct
gagaagaagaaggatgagcacgatgagttgtaa

DBGET integrated database retrieval system