KEGG   Magnaporthe oryzae: MGG_05996Help
Entry
MGG_05996         CDS       T01027                                 

Definition
ubiquitin C-terminal hydrolase
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MGG_05996
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGG_05996
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1024 aa AA seqDB search
MSNRHLPAGQAMEGAGSAGVAMSPSHGGPGPSPGPRRGGRPPAYHQSHSAYSATHHQQFQ
PHVQHPGVYSGYMGHPYANYGYPHTAPMPPPYQNGAQYYVPNMPGQPYMPYPAQYARSPP
SMHQYVHTMGTGAIPPQPVPQPQAYQRNQQSPIVVSSPYPNPPPPPRSASHNHAMVVPPQ
PIHSTPQQAAGQYVPQSVPQTAPRAQSDAAAHTAAPVAPVESEAPPTPSSSSSAQAQAPA
LPMTPPTPQTVETSVELSASPKAQAQVNLSPPQTTFTPPLPWSTHPDESWPKRANKIKRC
HKALDNQVQALSLPAMEESGPGATADRSVGATEGSAAPISKPAEATAAHGAGTSAAGEND
PFHAKWEAPVQADPVTHSPSSQDQPSGASTSPTTPASINATPSATSATPTPGKSKGTSRP
AAPAVPIIPAVPKGSPKEARLSQTDKVSVEQKVDSAASDADNTASTSTLSAGPSATESPS
SGPPPASAPAAPKLWTGLFSKAAAAAVSATPGESTPGQTGTNGTAATNSAAGNTATGTSG
FVQSKNNSLAEALRAYRVGNGDKLAFIEPRGLINTGNMCYMNSVLQVLLFCTPFYDFLEQ
AGKKVTHSFNSETPLIDAMIEFMRDFKIIDSAISVDQLRRRLKSEELEQYGEPFTPEFIY
EAIRKLPRFSSMRRGHQQDAEEFLGFFLESLHDECSHVMRAAGQQSITSTAPQSSAQTPT
TSAPSVDNDWLEVGPRQRAAITRSSGHSDMSSPVTKIFGGELRSELRVPGLKDSVTLEPY
QPLQLDIGAPQVRNIVDALRHLTNPESLRGDFNSPRGKDVSATKQVFIESLPPVLILHLK
RFQFDAEGNGTVKIWKKVGYPLELEIPREVLSRAKRTAGSLPKYKLIAAVYHHGKNASGG
HYTADVRRQDGTEWIRLDDTVIRRVRSEDVAEGGAEEDVVKGDNASRKDGGGYASAAANR
FAGMGEEDVTDDDGWKQVSTPASGGKKWSSLVNGASPTAANKGKQIKDNIKDNKVAYLLF
YQRI
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatcgtcatctgccggctgggcaggccatggaaggcgcggggagcgcgggcgtc
gccatgagcccttcacacggtggtcccggcccgagcccgggcccgcgcagaggtggtcgt
ccgccggcctatcatcagtcgcattccgcctatagcgccactcatcaccagcaattccaa
ccgcacgtccaacaccccggtgtctacagcggctacatgggccatccttatgccaactat
ggctacccccatactgctccgatgccgccgccctaccaaaacggcgcccagtactatgta
cccaacatgcctggccagccgtacatgccttaccctgcgcaatacgctcgttcgcctcca
agcatgcatcagtacgttcacacaatgggaactggcgcgataccgccccagcctgtaccg
cagccacaagcataccaacgcaaccaacagtcgcctattgtcgtctcatctccgtacccg
aatcctccacctcctcctcgatccgcatcccacaatcatgccatggtcgtgccccctcaa
ccgatacacagtactcctcagcaagctgctgggcaatatgttcctcagtccgtcccgcaa
accgctcctcgggcgcagagcgatgctgcggcccacacggccgctcctgttgctcctgtt
gaatccgaagcacccccgacaccttcatcaagcagctccgcacaggcacaggcaccagct
ttgcctatgacgcctccgacaccacagactgttgagacttcggttgagctgtctgcgagc
ccgaaggcccaggctcaagtcaacctctcgcctcctcaaacaacctttacgccacctctt
ccgtggtctacccatcccgacgagtcatggccaaagcgagccaacaagatcaagaggtgt
cacaaagcgctggacaaccaggtccaagcgctttcccttcctgcaatggaggaatcaggc
cctggtgcgactgctgatagatctgtgggggctaccgagggatctgcggcgcccatttca
aaacctgctgaggcgacagctgctcacggagcgggaacatcggctgctggcgaaaacgac
ccgttccatgctaaatgggaggcgcctgtacaagccgacccagtcacccactctccatct
tcacaagaccagccatccggtgcatccacatcccctacaacgcctgcttctatcaacgcc
accccgtccgccacatcagccaccccaactcctggaaaatccaagggtaccagtcgccct
gcagccccagccgtacccataataccagctgtacccaagggctcgccgaaggaggccagg
ctttctcaaacagacaaagtatcggttgagcagaaggttgacagtgctgcatcggatgct
gataacaccgcttccacttccactctgtctgctgggccaagcgctaccgagtctccatcg
tctgggcccccgcctgcctctgcgcccgctgctcccaagctatggactggactgttttcc
aaagctgctgctgctgctgtcagcgctactcccggtgaatccactcccgggcagactggc
accaatgggacggctgctacgaactctgctgctgggaatactgccacgggtacatctggc
tttgttcaatccaaaaacaactcgcttgccgaagccctgagggcataccgggttgggaac
ggagacaagctagcatttattgaaccgagaggcttgatcaacaccggaaacatgtgctac
atgaattctgtccttcaagtgcttcttttctgcacgcctttctacgactttctcgagcag
gcagggaaaaaggttactcatagcttcaacagcgaaactcctcttatcgatgccatgatt
gagttcatgcgcgacttcaagatcatcgactcagccatttcagttgaccagctgcgtcgc
aggctcaagagcgaagagcttgagcagtacggagagccatttacgcccgagtttatttat
gaggctatcaggaagctccctcgcttctcaagcatgaggcgcggtcatcaacaagatgct
gaagagttcctcggctttttcctcgagtcacttcatgatgagtgctcgcacgtgatgcgc
gcagctgggcaacaatcaatcacatccacagcccctcaatcatccgctcaaacacctacg
acatcagcgccctctgtcgacaacgactggctcgaggtcgggccccgacagcgggctgcc
atcacccgctcgagtggccactcagacatgtcatcacctgtcacaaagatctttggagga
gaacttagatccgaactgcgggttcctggcctcaaagactcggttacgcttgagccctac
caacccttgcagctggacattggcgctccccaagtgcgaaatattgttgacgctctgcgt
cacctgaccaatcccgagagccttcgtggtgatttcaactctcctcggggcaaggatgtt
tcggccaccaagcaggtcttcatcgagtcgctgccccctgtgctaatcctccacctcaag
cgatttcagtttgacgccgagggcaatggcactgtgaagatctggaagaaggtcggctac
ccactcgagctggagattccccgtgaggtcctctcccgcgccaagcgcacggcaggcagc
ttgcccaagtacaagctgattgcggcggtctaccaccatggcaagaacgccagcggaggc
cactacacggccgacgtccgccgccaggacgggaccgagtggatcagactggacgatacc
gttattcgacgcgtccgaagcgaggatgtcgccgagggcggtgcagaggaggatgtggtg
aagggtgacaacgcgtctcgcaaggacggcggtggctatgcctcggctgccgccaaccgc
ttcgcgggcatgggcgaggaggatgtgaccgacgacgacggatggaagcaggtcagcaca
ccggcgagcggaggcaagaagtggagcagccttgtcaacggtgcctcaccaacggccgca
aacaagggcaagcagattaaggacaacatcaaagacaacaaggtggcctacttgctcttc
taccagcgcatctag

DBGET integrated database retrieval system