KEGG   Magnaporthe oryzae: MGG_06089Help
Entry
MGG_06089         CDS       T01027                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mgr  Magnaporthe oryzae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MGG_06089
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MGG_06089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 326 aa AA seqDB search
MAQTPLITVLGSLNIDLVSYVPHHPLPGETLTANSFAVSPGGKGANQAIACAKLSRPQSD
KTAATANVRMVGAVGADSYGSLLRSNLEGHGVDVSGVAVRADPAKTGLAIIVVDEPTGQN
RIILSPESNHDLDKAVAIEAGLKDKPDLLIMQLEVPIPVVLEAMQAARTASVPVLLNPAP
AVELPASAFEGLEHLIVNETEASVLGRVAESVLDTEEGLRSVADGFVKAGVRNVVITLGG
RGVYFLQGWTGKAALVPALKATVVDTTAAGDTFVGMYALAAVAASKAGVDFDAEAAVRTA
NKAAAKTVERKGAQDSIPWRDELEGQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcccaaacgccactaatcaccgtcttgggctccctgaacatcgacctggtgtcgtat
gtgccccaccatcccctaccgggagagaccctcacggcaaactccttcgccgtctccccg
ggcgggaagggagccaaccaagccatcgcctgtgccaagctctcgaggccgcagagcgac
aagacggcggcgacggccaacgtgcgcatggtgggcgcggttggcgccgactcatacggc
agcttgctgcgcagcaatctcgagggccacggcgtcgacgtctcgggtgtggcggtgcgc
gcggacccggcaaagacgggcctggccatcatcgtggtcgacgagccgacgggccagaac
cgcatcatcctcagccccgagagcaaccacgacctggacaaggctgtagccatcgaggcc
ggactcaaggacaagcccgacctgctcatcatgcaactcgaggtccccatccccgtcgtc
ttggaggcgatgcaggccgcgcgcaccgccagcgtccctgtgctgctgaacccggccccc
gcggtcgagctgcccgcctcggcgttcgagggcctcgagcatctcatcgttaacgagacg
gaggcgtcggtgcttggccgcgtggccgagtcggtcctggacacggaggaaggactgcgg
tcggtggcggacgggttcgtgaaggcgggcgtgcgcaacgtcgtcatcaccctcggcggc
aggggggtttacttcctccaggggtggacgggcaaggcggctctggtgccggcgctcaag
gcgaccgttgttgacaccaccgcggcgggcgacacgtttgttggcatgtatgcgctagct
gccgttgcggcgtccaaggcgggcgtcgatttcgatgcagaggctgcggttaggacggct
aacaaagcggctgccaagacggtggagaggaagggtgcacaggattctattccatggaga
gatgagttggaggggcaatag

DBGET integrated database retrieval system