KEGG   Magnaporthe oryzae: MGG_06127Help
Entry
MGG_06127         CDS       T01027                                 

Definition
profilin
Orthology
K05759  
profilin
Organism
mgr  Magnaporthe oryzae
Brite
Exosome [BR:mgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MGG_06127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 131 aa AA seqDB search
MSWQGYVDQSLVGSGHIDKAAIISAAGDSTWATSADFTIEPAEMKTIADILDNKAGAQDK
AHSDGIYIAKERYVVARIEDNTIYARQGRSGVAIAKTSQAILVGHHNETTQAGNASQTVG
ALVDYLKPLGF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaaggatacgttgaccagagcctcgtcggctcaggccacatcgacaaggcg
gccatcattagcgccgcgggagacagcacttgggccacatcggccgactttacgatcgag
cccgccgagatgaagactattgcagacatcctagacaacaaggccggcgcacaggacaag
gcacattctgatggcatctatattgccaaggaacgctacgtcgtggccaggattgaggat
aacaccatttacgccagacagggccgatccggtgtcgccattgcgaagacgtcacaggcc
atccttgtcggccatcacaacgagaccacacaggctggaaatgcatcgcagactgtcggc
gccctggtggactacctgaagcctctgggattttaa

DBGET integrated database retrieval system