KEGG   Magnaporthe oryzae: MGG_06143Help
Entry
MGG_06143         CDS       T01027                                 

Definition
lysophospholipase NTE1
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MGG_06143
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MGG_06143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1503 aa AA seqDB search
MDSSTAALATASAKLDAVAQQGSSSWIGFFANIILGIISLVYSILYSVLKLTTFSIPSLL
YTLFSTSLTVTMNATTLMLIIVLVFSLVSWFVRYRYLNMYSRLPPEPQRKEPDVDLFPDT
HPGGSKPGLSNYLDEFLSAIKIFGYLERPVFHELTRSMQTRKLIAGETFNLEEEKGFCMV
VDGLVEIFVKSARTGQHPVGESCSIDSDGSDEHEEYQAGNQRYQLLTEVHNGAPMSSLFS
IMSLFTEDIKLRHGGDEGGEPTSATETYTSSRYGLGNDFSDQRESTVSVPTTPQLERSSS
HGPTLHDGDANPSMGGRVPASIPPMSLDPPLQSRPKRPTTSRHATTSVHPDIIARATVDT
TIAIIPASAFRRLIQIYPKYTAHIVHVILSRFQRVTLATAYNYLGLTSEVLHIEKSMIDN
ATCQLPNFLRGDALTRLKEKFNHERERIGEKDCTKGIALHNSSTGRRRKSTASLRKEAAL
QAITHGQRPSSVTASPPLQPRESGNKHTSNSGDLLMNIQLSRNGGRRSTSNMDPLTRQST
LLGSLETEVVSPLSQRTSNPFETRRHAHISLNKRETRDEDGLFRESILECMFKAIGLTAN
GTGAREPDSADASPRLTSYDQIRRGGYSSHNAFGFIDPYGGSVDGDADSITSGGTGPGLP
VNPHALAHDMRDEVEIVFFPSGSVLVEQGERNPGLYYVVDGFLDVCMSAADESSGDILKA
SKNESSLNIGPGNQQGSAGRDRFMDANLGQSSSRKRASNVRRNVALIKPGGLAGYVGSIS
SHRSFIDVVAKTDVYVGFLPRQSLERIVDRYPIVLLTMAKRLTNLLPKLILHIDFALEWL
QVNAGEVIFHGGEESEAIYIVLNGRLRLVEDRQEGGVDVRGEFGQGESIGELEVLTESAR
SGTLHAIRNTELVKFPRTLFNSLAQEHPNITIKISKIIASRMRKVVDDPSTFVGKEGALK
ASLNKSSSTLNLRTVAILPVTSGVPVVEFGNRLMGALTQVGTPNGATSLSQSAILNHLGR
HAFNKMGKLKLSQYLADLEEKYGLVMYVADTNVNSPWTQTCITQADCILLVGLAEGSPEI
GEYERFMLGMKSTARKVLVLLHADRYAEPGLTRSWLRNRMWINGGHHHVQMAFRTQSVPI
NPTAKRTGPSLKERVQILQAEIQKYTSRKVRHSPFYSPDAPFKGDFHRLARRLCGKSVGL
VLGGGGARGLAHIGIIRAMEESGIPIDIVGGTSIGSFVGALYARHADVVPIFGLSKKFAG
RMASVWRFALDLTYPSASYTTGHEFNRGIFKTFGKAQIEDFWLEFYCNTTNISKSRQEIH
TSGYAWRYVRASMSLAGLLPPLCDEGSMLLDGGYIDNLTVSHMKSLGVDIIFAVDVGSLD
DDVPQAYGDTLSGLWAFVNRWNPLSSTPNPPTLAEIQARLAYVSSVDALERAKMTPGCVY
MRPPIDEYGTLEFGRFDEIVQVGYKYGLEFLQKLRDEGALPVVEETEAKKALRRTMAPRR
ASI
NT seq 4512 nt NT seq  +upstreamnt  +downstreamnt
atggatagctcaacagcggcgctggctacggcgtcagccaagttggacgccgtagcccag
cagggctccagttcgtggattggcttcttcgccaacatcatacttggcatcatatcgctg
gtgtactctatactgtactcggtactgaagctcaccacattctcgattccctctctcttg
tacactctgttctccacgagtttgactgtcaccatgaacgcaacaacactcatgcttatc
attgttcttgtattctccctggtcagctggtttgtaagatatcgttacctcaacatgtat
tcacgtcttccgcctgagccgcagagaaaagaacccgatgtggatcttttccctgacaca
cacccagggggatcgaaacccggtctttcaaactacctggacgagttcctgagtgcaatt
aagatctttggatatctggagcgtcctgtctttcatgagctcacgaggagcatgcaaacc
cggaagctgatcgcaggagaaactttcaatctcgaggaagaaaagggcttctgcatggtg
gttgatggactcgttgagatctttgtcaaatccgctcgaacgggacagcatcctgtgggt
gagagttgctccatcgattctgatggcagtgatgagcatgaggaataccaggccggcaat
caacgctaccaactattgactgaagttcacaacggcgccccgatgtcgtcgctgttttct
atcatgtctttgttcaccgaagatattaagctcagacatggcggagacgaaggaggagaa
ccaacatcggcaactgagacttatacaagttcccggtatggtttgggcaatgatttctcc
gaccagcgcgagtctacagtttcggtgcctactacaccgcagcttgagagatccagctca
cacggcccaaccctgcacgatggtgatgcaaacccctcaatgggaggaagagtccctgca
agcatacctcccatgtcactggacccgccgctacaaagccgcccaaagcgcccgactact
tcacgtcacgcaacgacgtcggtgcacccggatattattgcacgcgcaacagtggatacg
acaattgctatcattcctgccagcgcattcaggcgtctgatccagatatatccaaagtac
acagcccatattgtgcacgtgatattatctcgctttcaacgagtcaccctggcaacagca
tacaactacctgggcctcaccagcgaggttttgcacattgaaaagagcatgatagataat
gcaacctgtcagcttcctaactttttgcgaggtgacgctctgacgcggctgaaggagaag
ttcaaccatgagcgtgaacgcatcggcgagaaggattgcaccaaaggtatcgcattacac
aattcttcgactgggcgccgccgcaagtccactgcctcacttcgaaaagaagcggctctg
caggccatcacacacggtcaaaggccaagctccgtgacggcttccccgccactgcagccg
cgagagagtgggaataaacatacgtccaactcaggcgacctcttgatgaacatccagctc
tcacgaaatggtggacgacgctcaacaagcaacatggatcctcttacaagacagtcgacg
ttattggggtcccttgaaactgaagtggtctctccgttgtcacaacgcacatctaatccg
tttgagacacggcgtcacgcgcatatttcgctcaacaagcgtgaaacgcgtgatgaagat
ggactattccgagagtccatcttggagtgcatgttcaaggctattggtctaactgcaaat
ggcactggggctcgcgaacccgattcagctgatgcatcgccgcgactgacctcttatgat
cagattcgtcggggtggctactcatcacacaacgcgttcgggtttatcgacccgtacggt
ggatctgtcgacggtgatgcagattcgatcacatccggtggaacaggccccggtctacct
gtcaacccccatgctctagctcatgacatgagagacgaagtcgagattgtgttctttccc
agcggctcagttttggtggagcagggcgagcgcaaccctggtctctactatgttgttgac
ggctttcttgatgtctgcatgtcagccgcagacgaatcatcaggcgatatattgaaagcc
tccaaaaacgaatcttctctgaacattggaccagggaaccaacaaggctcggctggtaga
gatcgttttatggatgccaacttaggacagagcagtagccgtaagcgggcaagcaacgtc
cgtcgcaatgtcgccctgatcaagcctggcgggcttgctgggtatgtcggtagcatctcc
tcgcaccgttcgttcatcgacgtggttgcaaagacggatgtctacgtgggctttcttccc
cgtcagtccttggagaggatcgttgatcgttatccgattgtcctgcttacgatggcaaag
cgtttaacaaacctgctacccaagttgattcttcacatcgacttcgctctcgagtggctt
caggtcaatgctggcgaagtcatcttccacggcggcgaagagagtgaagcgatttacatt
gttctcaatggtcgtcttcgacttgtcgaggaccgccaggaaggtggagttgatgtacgt
ggcgagtttggacaaggcgagagcatcggcgagctcgaggtcttgaccgaatcggcccga
tctgggactcttcatgcaatcagaaacacggagctggtcaagttcccgcgcacactattc
aacagcctcgctcaggagcatcccaacatcaccatcaagatctccaagataatagcgtca
aggatgagaaaagtcgttgacgatccttcgacctttgtcgggaaggaaggtgcattgaaa
gcgtcattgaataaaagctcatccaccttgaatctccgaactgtcgcaatcctaccggtt
acttccggggttcccgtcgtcgagtttggaaaccgcttgatgggtgctctcacccaggta
ggcacacccaatggtgctacttcgctgagccagtccgccatcctcaaccatctaggtcgg
cacgctttcaacaagatggggaagctcaagctttctcaatacctagccgaccttgaagag
aagtatggactggtgatgtatgttgcggataccaatgtcaattcaccctggacgcagacc
tgcattactcaggctgattgtatccttcttgtcggcctcgccgaaggctcgccggagata
ggagagtacgagcgattcatgctgggaatgaagtcgacagctcggaaggttttggtgctt
cttcatgccgaccgatatgccgagcccggactcaccaggtcgtggctgaggaaccgcatg
tggattaacggaggccaccaccatgtgcagatggctttccgcacacaatccgtaccgatc
aaccccacagccaagaggacgggccccagcctgaaagaaagggtccagattctacaggcc
gaaattcagaaatacacgtccaggaaggtccggcatagccctttctattcaccggatgcg
ccgttcaagggagatttccatcgattggccaggcgcctatgtggcaagtctgttgggctt
gtcctcggagggggtggtgcaaggggcctagcgcacatcggaatcatcagggctatggag
gaaagcggaatccccatcgacatcgtcggcggtacatctatcgggtcgtttgtgggagcg
ctttacgcaagacatgccgacgttgttcctatcttcggcttgtccaagaagtttgctggt
cgaatggcaagcgtgtggcgtttcgctctggacttgacatatccctcggcgtcgtatact
actggccatgagttcaaccgcggcattttcaagacctttggcaaggctcagatcgaggac
ttttggctcgagttttactgcaatacgacaaacatcagcaagagcaggcaggagattcac
accagcggctatgcatggcgctatgttcgagcctccatgtcactggccggcttgctgcct
cctctctgcgacgaaggcagcatgcttttggatggaggatacattgacaatttgactgta
tcacacatgaaatctcttggggtcgatatcatcttcgctgtggatgttggatctctggat
gacgacgtaccacaagcatacggagacacgctttcgggcttgtgggcctttgtcaatcgt
tggaatccactctcatcaacgcccaaccccccgaccttggccgagatccaggcccgactt
gcctacgtctcaagcgtagacgcactggagcgtgccaagatgacgcctggctgtgtctac
atgcggcccccgatagatgagtacggcactttggagtttggcaggtttgatgagattgta
caagtcggttacaaatacggcctagaatttttgcagaaactccgagacgagggtgcgctc
ccagtggtcgaagagacagaggccaagaaggcactacgccggaccatggcgcctcgcagg
gcaagcatttga

  All links  
No link information was found.   
DBGET integrated database retrieval system