KEGG   Magnaporthe oryzae: MGG_06175Help
Entry
MGG_06175         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MGG_06175
Enzymes [BR:mgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MGG_06175
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 722 aa AA seqDB search
MRPFALSLWLGLTLVSAVAGVGSDPSTEPTVFNDKTVPPMMELTPENFKEEIKAHKFIIV
KNFSPYCPHCQDYAPTFQTLYEFYYTSKPKGSTSDFTKYYDFHFASVNCIAYFDLCHENG
VGSYPTTILYKNGEAAETFKGVKEMDLLSETIEKALEAAKPGSRPKKISLPEPGAKSAPA
TDTDSSSSEKATTKETTKDAKAADKDVKPASGAEKSTTTAEDKKADADKTKSSTTKTDVA
EWWPEFTPPVRKPAKPVDPNPNGLSVSLTAETFQSLVTMTQEPWLIKFYAPWCSHCRAMA
SSWQQLAKDMKGRLNIGEVNCDVEARLCKDAPLRGYPTILFFKGGERVEYDGLRGLGDLV
HYAEKAIDISSGVQDVDAESFEALEKKEEVIFVYFYDHATTSEDFLALERLPLNLIGKAK
LVRTRDRRLYDRFKITTWPRLLVSREGRPTYYTPLTPDRMRDVNQVLTWMKSVWLPIVPE
LTASNAREIMDGRLVVLAILDRQNQDSYASAIREMKSAANEWTDKMIVAFQQERKELRDA
KQLRVEEAEDRGDQRALRAAKAIRINMDKSDRKEVGFAWVDGVFWQRWIRTTFGVDVKDG
ERVIINDEDNRRYWDQTITGNYILPSRTSILETIGQVTRNPNKIKPKLTISSFEKIFFDI
RMTFQEHPYLTAGCILGLALGGASWFRGRLRRNRGHFRLDDSMGRNEIKAPLLGANANGK
VD
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgaggcctttcgccttgtcgctgtggctcggcctcactctggtgagcgccgtagctggc
gtcggatcagacccgtctaccgaacctacagttttcaacgacaagactgtccccccgatg
atggagctgacaccagagaactttaaagaggagatcaaggctcataagttcataattgtt
aaaaacttcagtccatactgtcctcactgtcaggattatgcgcccaccttccagactctg
tacgagttctactacacgtccaagcccaaaggcagtacctccgactttaccaagtattat
gacttccactttgcgagcgtaaactgcatagcatacttcgacttgtgtcacgaaaatggc
gttggctcataccctactactattctctacaaaaatggtgaggctgcagaaactttcaaa
ggtgtgaaggagatggatcttcttagtgagacgattgagaaggcgctggaggctgctaaa
cctggcagccggcccaagaaaatctctcttccggagcctggcgccaagtctgcaccggcg
accgataccgattcttcgtcatctgagaaggccaccacaaaggaaactaccaaggatgca
aaggctgccgataaagacgttaagcccgcttcgggggctgaaaagtcaaccacaaccgca
gaagacaagaaggccgatgcggacaagaccaaatcgagcactactaagaccgacgttgcg
gagtggtggcctgagttcacgccgcctgtcaggaagcctgcgaagcctgttgacccgaac
ccgaacggtctctcagtgtccctcacggctgagactttccagtctttggtgacgatgacg
caggagccttggcttatcaagttctatgccccttggtgcagtcactgtcgggcgatggcg
tcgagctggcaacagctagccaaggacatgaagggccggctcaacattggcgaagtcaac
tgcgatgtcgaggctcgcctctgcaaggacgctcctctgcgcggctaccccaccattctg
ttcttcaagggtggcgagcgtgttgagtacgatggtcttcgcggcctgggtgacttggtc
cactatgccgagaaagccatcgacatctcaagcggcgtacaagacgtcgatgcggagtct
ttcgaggcccttgaaaagaaggaggaggtcatatttgtttacttctacgaccatgctacc
acaagcgaggacttcttggccctggagcgtcttcctctcaacctcattggcaaggcaaag
ctggtcaggacaagagatcgcaggctttatgacaggttcaagatcactacctggcctcgt
cttttggtctctcgtgagggacgtcccacttactacacgcctctgacccccgacaggatg
cgcgacgtcaaccaggtgctgacgtggatgaagtccgtctggcttcctatcgtgccagag
ctgactgcatccaacgctcgcgagatcatggatggaagactcgttgtgcttgccatcctt
gatcgtcagaaccaggactcgtacgccagcgctatccgtgaaatgaagagcgccgccaat
gaatggacggataagatgattgttgccttccagcaggagcgcaaggagctgcgcgatgcc
aagcagcttcgcgtcgaggaggccgaggaccgcggcgatcagcgggctctgcgggcagcc
aaggccattaggatcaacatggataagtcggaccgcaaggaggttggctttgcttgggtc
gacggtgtgttctggcagaggtggatccgcacaacctttggcgtcgatgtcaaggatgga
gagcgcgtcataatcaacgatgaggataaccgccgctattgggaccagaccatcactgga
aactacatcttgccgtctcggacatccatcctcgagaccatcggccaggtcaccaggaat
cctaacaagatcaagcccaagttgaccatttcgagcttcgagaagatcttcttcgatatt
cgcatgaccttccaagaacacccgtacctgactgctggctgcattctcggcttggcactt
ggtggtgcttcttggttccgtggacgtcttcgacgcaaccgtggtcacttccgacttgat
gacagcatgggcaggaatgagataaaagctcctcttcttggtgccaacgccaacggcaag
gtggactaa

DBGET integrated database retrieval system