KEGG   Magnaporthe oryzae: MGG_06319Help
Entry
MGG_06319         CDS       T01027                                 

Definition
ubiquitin C-terminal hydrolase L3
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGG_06319
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   MGG_06319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 256 aa AA seqDB search
MSATTNNPGAHYDDKGKKTFVPLENNPAVFNDLVHRLGLSSELGFYDVYSIDEPDLLAFV
PRPVHALIFIVPAPVYYRVREHDGSEEITYDKAGEQEPVMWFEQTIGHACGLYSLIHAVA
NGSARQHIKRDSLIDKILAEALPLKRAQRADILYNSKALEDAHMSCAVGGDSIVPEATEP
VGYHFITFAKGKDGHLWELEGSWDPIDRGVLDDSDDMLSEKALKLGIRKFLHECQATGMI
EFSIVALATRPEVDDN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaacgacgaacaatcctggggctcattacgatgacaagggcaagaagactttt
gtgcctctcgagaacaaccctgccgtcttcaacgacctcgtccaccgcctgggtctctct
tccgagctcggcttctacgatgtctattccatcgacgagccagatctgctcgccttcgtc
ccacggcccgtgcatgctttgatattcatcgtccctgctcctgtctactatcgcgtcaga
gagcatgacggcagtgaagaaatcacatacgacaaggctggcgagcaagaacctgtcatg
tggttcgagcagaccatcggccatgcctgcgggctttactcgctcatacacgccgtcgca
aacggaagtgctaggcaacatatcaagcgagactctctgatcgataagattttggctgaa
gccttgccgttgaagcgtgcccagcgcgccgacatcctctacaactccaaagcacttgag
gatgcgcacatgtcttgtgcggttggtggcgactccattgttccggaagctactgagccc
gtgggctaccactttatcacttttgccaagggcaaggatggtcacctgtgggaactggag
ggcagctgggatcccatcgatcgtggcgttctagacgactccgacgatatgctgagcgag
aaggcgctgaagctgggaattcggaagtttctgcacgagtgtcaagccaccgggatgatc
gagttctccatcgttgctttggcgacgcgtccagaggtcgacgataattag

DBGET integrated database retrieval system