KEGG   Magnaporthe oryzae: MGG_06368Help
Entry
MGG_06368         CDS       T01027                                 

Definition
AGC/PKA protein kinase
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    MGG_06368
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     MGG_06368
Protein kinases [BR:mgr01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   MGG_06368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 539 aa AA seqDB search
MPSLGFLKKKRTRDGNNDNSSQPASPVTPTAAQSFEQAQVLGAPSAINNSHAHTQQQSYL
VPQPGYSVGTEVQAQQPQMNSISQQQQQAFAPPAHTPSPGTIDPQQSLPSISNLMNPAVQ
QQNSQPSANFQPQSQSQSQSQSQFPLPPSHGNGDQSQQQNFQVQQQIQSQQDAMDIQPSQ
VQDQSHSQQAQPQHQPQHHVQHHVNHAHQGSQDQQTRVTKGKYSLTDFEILRTLGTGSFG
RVHLVQSRHNQRFYAVKVLKKAQVVKMKQVEHTNDERKMLGEVKNPFLITLWGTFQDCRN
LYMVMDFVEGGELFSLLRKSGRFPNPVAKFYAAEVTLALEYLHAKNIIYRDLKPENLLLD
RHGHLKITDFGFAKRVPDKTWTLCGTPDYLAPEVVSNKGYNKSVDWWSLGILIYEMLCGY
TPFWDSGSPMKIYENILKGKVRYPAYINPDAQDLLQRLITADLTKRLGNLYGGSQDVRNH
PWFAEVTWDRLARKDIDAPYTPPVKAGAGDASQFDRYPEETERYGQTGHDEYGNLFPGF
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgccttctctaggttttcttaagaaaaaaaggactagggacggaaacaacgacaactca
agccaaccagcaagcccagtcactccgactgcagcccagagtttcgagcaggcgcaagtc
ttaggtgcaccttctgccatcaacaactcccacgcacatacgcagcagcagtcttacttg
gtgcctcagcccggctactcggttgggacagaagtacaggctcagcagcctcagatgaac
tcaatttcacaacaacaacaacaggcgtttgcgccgccagcacatacaccctcgccgggg
actattgatccgcaacaaagcctgccgagcatctctaacctcatgaaccccgcagtccaa
caacaaaacagccagccctcggccaacttccaacctcagtcgcagtcacagtcacaatcg
caatctcaatttccgctcccaccgtcgcacgggaatggcgatcaaagccagcagcaaaat
ttccaggttcaacagcagattcagtcacagcaggacgccatggatatacagccttcgcaa
gtgcaggaccagtcccattctcagcaggcgcagcctcagcaccaaccacagcatcatgtg
cagcaccatgtaaatcatgcgcatcaaggatcccaagaccagcagacaagggttacgaag
gggaagtactcgctgaccgatttcgagatcctccggacgcttggtaccggtagcttcggt
agagtgcacttggtccagtcaagacataatcaaagattctacgctgttaaggtcttgaag
aaggctcaggtggtcaagatgaagcaggttgagcataccaacgacgagcgcaaaatgctg
ggcgaagtcaagaatccgttcctgattacgttgtggggtactttccaagactgcaggaac
ctgtacatggtcatggatttcgtcgaaggtggtgagctcttctcgttactgagaaaatcg
gggcgcttcccaaacccagtagcaaagttctacgcggccgaggtaacattggctctcgaa
tatctacacgccaaaaacatcatataccgtgacctgaagcccgaaaacctgttacttgac
cgacatggccacctcaaaatcaccgactttgggttcgccaagcgtgtaccggacaagaca
tggactctttgtggcactccggattacctggcgccggaggtagtttccaacaagggctac
aacaagtctgttgactggtggtctttgggaatactgatatacgagatgctgtgcggctat
acccccttctgggatagcggatctcctatgaagatatacgagaatatcctgaagggcaaa
gttcgttatcccgcctatatcaacccggacgcgcaagacctgttgcaacgtctcatcacg
gcagacttgacaaagaggttaggaaacctttatggcggatcgcaagatgtcaggaaccac
ccatggtttgccgaggtgacatgggatcgccttgcgcgaaaggacatagatgcaccatac
acacctccagtcaaggccggcgcgggcgacgcaagccagtttgatcgatatcccgaagaa
acagaacgatatggccagactggtcatgatgaatacgggaatttgttccctggattctga

DBGET integrated database retrieval system