KEGG   Magnaporthe oryzae: MGG_06399Help
Entry
MGG_06399         CDS       T01027                                 

Definition
CMGC/DYRK/YAK protein kinase
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mgr  Magnaporthe oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1001 aa AA seqDB search
MEQWQSPYSDAAGASRRYNSSASNSNSNSNSVGQGHNHLSRDFNGQQQQHLNQQQNQHHQ
HHHQQQQQQHHTPQPPIAFKYDQYPSSQQSQIYHQQQQQHHHNQQQQQQQPHQQQHHHHI
PSLNTATSPIATPQIRDGNGDVAMSDAHDQYSGMKYPMRPHHQAHLSAGARPSNLHSPQE
SSAAAQRYSPMEVMSPTSPYSPYTPKSSSAGGGSHFSSLPPQQRQSPTRGASDYGNSLHS
PYPPQSPYYPSRQSSQSQGHSQSGSQQLPPISSHTGAYDGFSLSATTPTTEALYPPDPKS
PRRVMPPPTYSAPQPVPELKKLRALSDLRPKVSAQPPFRRANPEGGFISPLQALTVHLPA
TYRICNPSFKYESSRNPRRVLTKPSKGTKNDGYDNEDSDYILYVNDILGSEEAGHKNRYL
ILDVLGQGTFGQVVKCQNLKTQEVVAVKVIKNRTAYFNQSMMEVSVLDLLNTKLDKNDDH
HLLRLKDTFIHRQHLCLVFELLSVNLYELIKQNQFRGLSTTLVRVFAQQLLNGLALLNKA
RLIHCDLKPENILLKNLESPIIKIIDFGSACDERQTVYTYIQSRFYRSPEVLLGLPYSSA
IDMWSLGCIVVELFLGLPLFPGSSEYNQVSRIVEMLGNPPNWMLEMGKQSGEFFEKRQDE
FGRRTYQLKSMEQYSKEHGTKEQPSKKYFQANTLPEIIKTYPMPRKNMKQSEIDREMNNR
IAFIDFVRGLLTINPLERWSPQQAKLHPFITQQKYTGPFVPPMNLKSSSLNRSPAPGTQQ
QQQAEALSKQRAQAAQAQANSAVQGAYASMASPAQYQHQPGHPPSAPPVYANNSVYAAGG
SHAPPAPPPYATSQGAYGQMSQSQPPAQMPPANYAGVPPQQGQQQQQHQSQNNMYAQQRS
RPRASTMEQHHQSGIPAAIQRVASHLDPSQPIRLQPSPAYYPPPSDSGALMDNTPGRMGP
NRRGSRAQPGGRGNNKDFIRNLEERTLEEGFMSSSQQGSWN
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atggaacagtggcagtcaccatactcggacgctgctggcgcgtctcgacgttacaacagc
agcgccagcaacagcaacagcaacagcaacagcgtcggccagggccacaaccatttgtcg
cgggacttcaatggtcagcaacagcagcacctgaatcaacaacaaaaccaacaccaccaa
caccaccatcaacaacagcagcaacagcaccacacgccacagccgccaatcgcattcaag
tacgatcagtacccgagctcgcaacagtcgcagatttaccatcagcaacaacagcagcat
caccacaaccagcagcaacagcaacagcagccgcaccaacaacaacaccatcatcacatc
ccgagtctcaataccgccacatcgccaattgccacgccgcagataagagacggcaacggc
gacgtcgccatgtcggacgctcacgatcaatactctggaatgaagtatccaatgcggccc
caccaccaagcccacctcagtgccggcgcccgtccctcgaacctgcactccccccaagag
tcgtcggctgccgctcaaaggtattcgcccatggaggtcatgtcgcctacgtcgccgtac
tccccttacacgccaaagtcatcgtcggctggcggcggtagccacttctccagcttgccc
ccgcagcagcgtcagtcgcctacgcgtggtgcttccgactacggaaactccctgcacagc
ccgtaccctcctcagagtccatactacccgagtcgtcagtcatcccagtcccagggtcac
tctcaatcgggctcgcagcaactgccgccaatttcgtcgcacacgggcgcctatgatggc
ttctccctatctgcaaccaccccgacgaccgaggcgctctatcccccggaccccaagtcg
ccgaggcgtgtcatgcccccgcccacatattctgcccctcagcccgttcctgagctcaaa
aagctgcgggccttgtcggatctgcgacccaaagtcagcgcgcaaccacctttccggcga
gccaaccccgagggtgggtttataagccccctgcaagctttgactgttcacctgcctgca
acgtacaggatttgcaaccccagcttcaagtacgagtcctctcgcaacccgcgtcgggtt
cttaccaagcctagcaagggtaccaagaacgacgggtatgataacgaggacagcgattac
atcctctacgtcaatgatatcctcggatctgaggaagctggacacaagaaccgatatctg
atcttagacgtgttgggccaaggaactttcggccaggtggtaaagtgtcagaatctgaag
acgcaggaggttgtagctgtgaaagtgatcaaaaaccgcaccgcctatttcaaccagtcc
atgatggaggtctcagtactcgatctgctcaacacaaaactcgacaagaacgacgatcac
catctcctgcgattaaaagacacattcattcatagacagcatctttgcctagtgtttgag
ctactgagtgtgaatctttatgagctaatcaagcaaaaccagttcagaggccttagtacg
acacttgttcgtgtctttgcacagcaactactcaacggccttgcacttctcaacaaggcg
cgactgatacattgcgatctcaagcccgagaatattttgctgaagaatctcgagagccca
ataatcaagattatcgacttcggctcggcatgcgatgaacggcaaacagtctacacttac
atccagtcacgattctaccggtctcccgaggtcctcttggggctgccgtactcgtctgcc
atcgacatgtggtcgcttggttgtattgtggtggagctgtttcttggtctgccgctcttc
cctggatcatccgaatacaaccaggtatctaggatcgttgagatgctgggcaacccgccc
aactggatgctcgaaatgggcaagcagtctggggagttcttcgagaaacgacaggacgag
ttcgggaggcgaacataccagctgaagagcatggagcagtactcaaaagagcacggcacg
aaggaacaacccagcaaaaaatacttccaggccaacactctgccggaaattatcaaaaca
tacccgatgccacggaagaacatgaagcagagcgagattgacagagaaatgaacaacagg
attgcgttcattgactttgtcagggggctgttgaccatcaatcccttggaaaggtggtct
cctcaacaagcaaagcttcatcctttcatcactcagcagaagtacacagggccctttgtt
ccgcccatgaacctcaagtcaagctccctcaaccgatccccggcacctggaacccaacag
caacaacaggctgaggctcttagcaagcagcgagcccaagccgcacaggcacaagccaat
tccgcggttcaaggagcatatgcatcaatggcttcgccggcgcagtatcagcaccaacct
ggtcacccgccgtcagctccaccagtgtatgccaacaattctgtttacgctgcgggcggc
agtcatgcaccaccagcgcctccaccgtacgcgacctcgcagggtgcgtacggacagatg
tcgcagtctcagccgccggcgcagatgcctccagccaactacgcaggtgttccgccccaa
cagggacagcagcagcagcagcaccagtctcagaataacatgtatgctcagcagaggtcc
cgcccgcgagcgtctaccatggagcaacatcaccagagcggtattcctgcggcgatccaa
agggtggccagccacctggatcccagccagccaattcgactacagcccagcccagcatac
tacccccctccctccgatagcggtgctcttatggacaacactcctggccgtatgggccct
aacagaagaggtagtcgtgcgcaaccaggaggtcgcggcaacaacaaggactttatccgc
aatctagaggagcgcacactcgaagaaggttttatgagcagttctcagcaaggctcttgg
aattga

DBGET integrated database retrieval system