KEGG   Magnaporthe oryzae: MGG_06482Help
Entry
MGG_06482         CDS       T01027                                 

Definition
STE/STE7 protein kinase
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
mgr  Magnaporthe oryzae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    MGG_06482
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     MGG_06482
Protein kinases [BR:mgr01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   MGG_06482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 515 aa AA seqDB search
MKNPISSLDVPTPPATTIPTLSSPAPLLRPAIPGARSAGARTPRLGLAIPPSPNVKPVGG
APGRPPLPTLHLATPMGSSVTPHEQPPGRPSIVTQQGQSASGGSESSAAHSRSGSFGPLD
GRTSNPTSAGSQYSALSFASHFGIGSTRPQGTPDPASAVGSIYSERSDGGAGMDKDGNLK
GLENFDKLTIDKARTADVEDLDVEGWKIASMEKRIVELGGLGEGAGGAVTRCKLTGGKTV
FALKVITANPDPDVKKQIMRELDFNIQCASEHICRYYGAFEDPSTATISIAMEFCEGGSL
DSIYKEVKRLGGRTGEKVLGKIAEGVLRGLTYLNSKKIIHRDIKPSNILLCRNGDVKLCD
FGVSGDFGTKGEANTFIGTSYYMAPERITGQSYTITSDVWSTGVTLLEVAQHRFPFPADG
TEMAPRAGLIDLLTYIVRQPIPKLKDEPSAQISWSENFKYFIECCLEKDPQRRASPWRML
EHPWMVDMKSKRVNMTRYLAQVWGWDDKGEAKPAE
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatcccatatctagtctcgatgtccccacgccgccagccaccacgattcccact
ctatccagcccagcgccacttttgaggcccgcgatacctggagctcgctcagctggtgcc
cgcacacccaggctcggcctggctatccctccatctccaaatgtgaaaccggtcggcggc
gccccggggcggccccccctcccaacactacatctagcaacacctatgggcagttctgtg
acgccgcatgagcagccgccaggccggcccagcatagtcacacaacagggccagagtgca
tctggtggtagcgaaagcagcgccgcccacagtcgttcgggctccttcggaccacttgat
ggtcgcacttccaaccccaccagcgccggctcgcaatactcggcgttatcttttgctagt
cactttggcatagggtccacgaggcctcagggaacgcccgaccccgcctcagctgttggt
tcgatttactcagagaggagcgacggaggtgctgggatggacaaggatggcaacctgaaa
ggactggagaatttcgacaagctgacaatcgacaaggcgaggacggcggacgtcgaagat
ctcgatgtggagggctggaagattgctagcatggagaagcgcatcgttgagctcggaggg
ctaggtgaaggcgccggtggtgctgtaacgaggtgcaaactgactggagggaagacggta
ttcgccttaaaggtgatcacggccaacccagaccccgatgtgaagaagcagatcatgcga
gagttggatttcaacatccaatgcgcttcagaacacatatgcagatactacggcgcgttt
gaggacccatctaccgcaacaatctctatcgcaatggaattttgcgaaggaggatccctc
gacagcatctacaaggaagtcaaacgactcggtggacgcacgggcgagaaggtgctcgga
aagattgcagaaggtgttttgcgaggcctgacttatctcaactcgaagaagattattcac
cgcgacatcaaaccctccaacattcttctctgccgcaacggtgacgtcaagctctgcgac
tttggagtgtcgggtgactttggtaccaagggcgaggcaaacaccttcattggaacgagc
tactacatggcgcccgagcgcatcacgggccagagttacaccataacatcggacgtctgg
tcaacgggcgtcacgctactcgaggttgcacaacaccgctttcccttcccggccgacggc
actgagatggcacctcgtgcagggctcattgacctacttacgtacatcgtgcggcagccg
attcccaagctgaaggacgagccttctgctcaaatctcatggagtgaaaatttcaaatat
ttcatagagtgctgcctggagaaggatccgcaaaggagagcaagcccttggaggatgctt
gagcacccatggatggttgatatgaagtctaagcgtgtcaacatgacgcgttatctcgcg
caagtctggggctgggacgacaagggtgaagccaagcctgcagagtga

DBGET integrated database retrieval system