KEGG   Magnaporthe oryzae: MGG_06685Help
Entry
MGG_06685         CDS       T01027                                 

Definition
cytochrome c
Orthology
K08738  
cytochrome c
Organism
mgr  Magnaporthe oryzae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MGG_06685
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 108 aa AA seqDB search
MGFSEGNAKNGAKLFKTRCEQCHTVDAAGGNKIGPALHGLFGRKTGSVDGYAYTDANKQK
GITWDENTLFDYLENPKKYIPGTKMAFGGLKKEKDRNDLITFLKENTK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtttctctgagggcaacgctaagaacggcgctaagctgttcaagactcgctgcgag
cagtgccacaccgtcgacgctgccggcggcaacaagatcggccctgccctgcacggcctt
ttcggccgcaagaccggctcggtcgacggctacgcttacaccgacgccaacaagcagaag
ggcatcacctgggacgagaacaccctgttcgactaccttgagaaccccaagaagtacatt
cccggcactaagatggctttcggtggcctcaagaaggagaaggaccgaaacgacctgatc
accttcctcaaggagaacaccaaataa

DBGET integrated database retrieval system