KEGG   Magnaporthe oryzae: MGG_06731Help
Entry
MGG_06731         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
mgr  Magnaporthe oryzae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MGG_06731
   00240 Pyrimidine metabolism
    MGG_06731
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MGG_06731
   03410 Base excision repair
    MGG_06731
   03420 Nucleotide excision repair
    MGG_06731
   03430 Mismatch repair
    MGG_06731
   03440 Homologous recombination
    MGG_06731
DNA repair and recombination proteins [BR:mgr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      MGG_06731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 192 aa AA seqDB search
MPTTRRSASAQGAASKQSKLSFTHRVTKPVAPAGKKQLVSPPLVKELLSEKKVDPVPEIQ
LEQEEEFEIPAPVEVVKEKSEVEIRAEKITSAQINKYWEELEAQRLAPRVHQEDLDVGEK
VLRYFDVSSQYGPCIGSSRKRRWMRAQRLGLNPPIEALAVLVHEEAAGQDEGSQRAYIDE
IMNSTAIGVGSS
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccacgcggaggtccgccagcgcccagggtgcagcaagcaagcaatcaaagctc
agttttacacaccgcgtgacaaaacctgtcgcgccggctggcaagaagcagcttgtctcc
ccaccgctggttaaggaactactttcggagaagaaagtcgacccagtgccggagatccag
ttggagcaggaggaggagtttgagatcccggccccagtcgaggttgtcaaggagaaatca
gaagttgagatcagagccgagaagatcaccagcgcacaaatcaacaagtattgggaggaa
ctagaggcgcagagattagcaccaagggtacatcaagaagacctcgatgttggcgagaag
gtgctgagatactttgatgttagctcacagtatggaccatgcattggtagttcgcgcaag
aggaggtggatgcgtgcccagcgtttgggactgaaccctccaattgaggcacttgctgtt
ctagtacacgaggaagctgctggccaagacgagggcagccagagagcatacattgatgag
atcatgaactcaacagcgataggagttggcagttcgtga

DBGET integrated database retrieval system