KEGG   Magnaporthe oryzae: MGG_06764Help
Entry
MGG_06764         CDS       T01027                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
mgr  Magnaporthe oryzae
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mgr00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 242 aa AA seqDB search
MSKLGLPGLFRPASSLLRNGCNTTPFCNLPRHITRTASSSPTFTNARMSSTQPTDRRPLV
ICGPSGVGKGTLIQMLFQRHPETFTLSVSHTTRAPRPGEQDGVHYHYVTKEQFQALIAED
KFVEHAQFGSNNYGTSKATIEEQTAKGKVVVLDIEMEGVKQVKKSSISARYVFISPPSEE
ELEKRLRGRGTENEDSVNQRLNRAKEELAWSKTEKFDKVLVNDDLEKTFKELDEFVYEMP
AQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgggattgccgggcttgttccgccccgcgtcgtcgctccttcgcaacggc
tgtaacaccacacccttttgcaacctgcctagacacataacccgcaccgcgtcgtcgtcg
ccgacttttacaaacgccagaatgtcctccacacaacccactgaccgccgccccttggtc
atctgcggtcccagcggcgtcggaaagggcaccctgatccagatgctcttccagcgtcac
ccggaaacatttaccctttccgtgtcgcacacgacgcgcgcgccgcgccccggcgagcag
gacggcgtgcactaccattacgtcaccaaggagcaattccaggccctgattgccgaggac
aagtttgtcgagcacgcccagttcggcagcaacaactacggcaccagcaaggctaccatc
gaggagcagacggccaagggcaaggttgtggtgctcgacattgagatggagggtgtcaag
caggtcaagaagtccagcatatcagcccgctacgttttcatctccccgccgtcggaggag
gagctcgagaagcgcctgcggggtcgcggaaccgagaacgaggacagcgtcaaccagcgc
ctgaaccgcgccaaggaggagctcgcctggtccaagacggaaaagtttgacaaggtcctc
gtcaacgacgacctggagaagacgttcaaagaactcgacgagtttgtttacgaaatgccg
gcacagtag

DBGET integrated database retrieval system