KEGG   Magnaporthe oryzae: MGG_06764Help
Entry
MGG_06764         CDS       T01027                                 

Definition
(RefSeq) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00230  Purine metabolism
mgr01100  Metabolic pathways
Module
mgr_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MGG_06764
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MGG_06764
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 AAA_22 RsgA_GTPase Rad17 ABC_tran MMR_HSR1 AAA_28 Septin ATPase_2 AAA_24 RNA_helicase AAA_14 AAA_29
Motif
Other DBs
NCBI-GeneID: 2684937
NCBI-ProteinID: XP_003709479
UniProt: G4MLN4
Position
1
AA seq 242 aa AA seqDB search
MSKLGLPGLFRPASSLLRNGCNTTPFCNLPRHITRTASSSPTFTNARMSSTQPTDRRPLV
ICGPSGVGKGTLIQMLFQRHPETFTLSVSHTTRAPRPGEQDGVHYHYVTKEQFQALIAED
KFVEHAQFGSNNYGTSKATIEEQTAKGKVVVLDIEMEGVKQVKKSSISARYVFISPPSEE
ELEKRLRGRGTENEDSVNQRLNRAKEELAWSKTEKFDKVLVNDDLEKTFKELDEFVYEMP
AQ
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaactgggattgccgggcttgttccgccccgcgtcgtcgctccttcgcaacggc
tgtaacaccacacccttttgcaacctgcctagacacataacccgcaccgcgtcgtcgtcg
ccgacttttacaaacgccagaatgtcctccacacaacccactgaccgccgccccttggtc
atctgcggtcccagcggcgtcggaaagggcaccctgatccagatgctcttccagcgtcac
ccggaaacatttaccctttccgtgtcgcacacgacgcgcgcgccgcgccccggcgagcag
gacggcgtgcactaccattacgtcaccaaggagcaattccaggccctgattgccgaggac
aagtttgtcgagcacgcccagttcggcagcaacaactacggcaccagcaaggctaccatc
gaggagcagacggccaagggcaaggttgtggtgctcgacattgagatggagggtgtcaag
caggtcaagaagtccagcatatcagcccgctacgttttcatctccccgccgtcggaggag
gagctcgagaagcgcctgcggggtcgcggaaccgagaacgaggacagcgtcaaccagcgc
ctgaaccgcgccaaggaggagctcgcctggtccaagacggaaaagtttgacaaggtcctc
gtcaacgacgacctggagaagacgttcaaagaactcgacgagtttgtttacgaaatgccg
gcacagtag

DBGET integrated database retrieval system