KEGG   Magnaporthe oryzae: MGG_06786Help
Entry
MGG_06786         CDS       T01027                                 

Definition
protein disulfide isomerase
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    MGG_06786
Enzymes [BR:mgr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MGG_06786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 471 aa AA seqDB search
MHHPTSLCAVATAVLAILPGAQAGFYPKSSGVLEITGKNYQDLVANSNKTTILEFFAPWC
GHCKNLKPAYEKAAKNLEGLAKVAAIDCDDEMNKPFCGSMGIQGFPTLKIVRPPMNKGKP
LVEDYNGPRSPSGIVDAVVERINNHVKRVTDKDLDDFLSKTEGPKAILFTEKGTVSTLLK
GVAIDFLDVIKIAQIRNKEKGAVEKFGIEKFPTLILIPGKGEEPIKYDGPVKRADMVKFL
SQAGGPNPDPAPKKKADKKSKKAGTKKAEPEDTPSAESAESTETVKTPVITEAAPPIPTI
HDSSKLAKECLNEKSTTCVLAFVPAEAERSKDTQAALDALADLVHKYAQAKRKLFPFFAI
PSSNPSSASVIKALELGDKPIQLVAVNARRNWWRQHPGEDFSAQGIENWVDAIRMGEGAK
KKLPEGLVIEAAEATGAEDKAGTASESTSETKGSDPVPEPETAKPAGHDEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaccccacgtcactttgcgccgtcgcaacggcagtgttggcgattcttccaggc
gctcaagctggcttctaccccaagagctcaggcgtcttggagatcactggcaaaaactac
caagacttggttgccaattccaacaaaaccactatactcgaattctttgcaccatggtgt
ggacattgcaagaacctgaagccagcgtacgaaaaggctgccaagaaccttgagggtctg
gcaaaggtggcagcaatcgattgcgatgatgagatgaacaagccgttctgcggctccatg
ggtatccagggcttccctactctcaagattgtgcgcccgccaatgaataaaggaaagcca
ctagttgaggactacaatggcccgcgttcgccttctgggattgttgatgctgtcgtcgaa
cgaatcaacaaccatgtcaagagggtcacagacaaggacctcgacgactttctctccaag
accgaagggcccaaggccattttgtttacggaaaagggcaccgttagcacacttctcaag
ggtgtagccattgactttttagatgtcattaaaatcgcgcagatcaggaacaaggagaag
ggcgccgtggaaaagttcggcatcgagaagtttcccaccctgatactcatcccaggaaag
ggagaggagccgatcaagtacgacggtccggttaaaagggcagatatggtgaagttcttg
tctcaggctggtgggccaaaccctgacccggcaccgaagaagaaggcggacaagaagtca
aagaaggctggcaccaagaaggctgagcccgaggatacaccatctgccgagtcggccgag
tcgaccgagactgtcaaaacacctgtcatcactgaggctgcaccaccaattcccaccatc
cacgactccagcaagctggccaaggagtgcctcaacgagaaatcaactacttgtgtgctc
gctttcgtgcccgccgaagccgagcgtagcaaggacacccaggctgctcttgacgctctg
gcagaccttgtgcacaagtacgcacaggccaaacgcaagctgttcccattctttgccatc
ccgagcagcaaccctagcagcgcgtctgtcatcaaggccttggagcttggggacaagcct
atccaactggtcgccgtcaacgccaggaggaactggtggaggcagcatcctggcgaggat
ttcagcgctcagggcatcgagaactgggtcgacgcgatccgtatgggtgaaggcgccaag
aagaagctacctgagggtcttgtgatcgaggctgcggaggctaccggtgctgaagacaag
gccggtactgccagcgagtctacaagcgagaccaagggctctgaccctgtgccagagcct
gagactgccaagcctgccgggcatgacgagctgtga

DBGET integrated database retrieval system