KEGG   Magnaporthe oryzae: MGG_07117Help
Entry
MGG_07117         CDS       T01027                                 

Definition
NADPH-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
mgr  Magnaporthe oryzae
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 690 aa AA seqDB search
MAELDTLDIIVLGLILCGTIAYFTKGKYWGVVKDPYAASFANTNGPKTGKTRNIVEKMEE
TGKNCVIFYGSQTGTAEDYASRLAKEGKSRFGLETMVADLEDYDYENLDTVPSDKIVMFV
LATYGEGEPTDNAVDFYEFITGEDVSFSEGSTLDNLNYVAFGLGNNTYEHYNSMVRNVNK
ALEKLGAHRIGDAGEGDDGAGTMEEDFLAWKDPMWAALAEKMGLEEREAVYEPVFSVTER
EGLTVESPEVYLGEPNKMHLEGTAKGPFNAHNPYIAPIVKSYELFNVKDRNCLHIDVDVS
GSNLTYQTGDHIAVWPTNPGEEVDCLLDVLGLTDKRDTVVSVRPLEPTAKVPFPAPTTYD
AILRYHMEICAPVSRQFIATLAAFAPDEETKAEMTKLGGDKDYFSAKISKHYLNIARVLF
NVGKGKKWNNIPFSAFIEGLTKLQPRYYSISSSSLVQPKVITITAVVEKQEIPGRDDPFR
GVTTNYLLALKQKQNGEPHPEPFGRTFALAGPRDKYDGIKVPVHVRHSNFKLPSDSTKPI
ILVGPGTGVAPMRAFVQERAKQAENGEEVGKTILFFGCRKSTEDFLYKDEWDEYKKVLGD
KFELVTAFSREGPKKVYVQHRLKERAQEINELLTKKAYIYVCGDAANMAREVNSVLGQII
AEQRGIPEAKAEEIVKNMRAANQYQEDVWS
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggccgaactcgacactctggacatcattgtcctcgggctgatcctttgcggcactatt
gcgtatttcaccaagggcaaatactggggggtagtcaaagacccttacgcagcttcattt
gccaacacaaatggacccaagacaggcaagacgagaaacattgtggagaagatggaggag
acgggcaagaattgtgtgatcttctacggctcgcagacaggtaccgccgaggactacgcc
tccaggcttgcaaaggagggaaagagccgcttcggactcgagacaatggttgccgatctt
gaggactacgactacgaaaacctggacaccgtcccgagcgacaagattgtcatgtttgtt
ctcgccacctacggagagggcgagcctaccgacaacgccgtggacttttacgagttcatt
accggagaggatgtctcgttttccgaaggcagcactcttgacaacctgaactacgtcgct
ttcggtctcggcaacaacacctatgagcactacaactccatggtacgcaacgtcaacaag
gccttggagaagcttggtgcgcaccgcatcggcgacgcaggagagggcgatgacggcgct
ggcacaatggaggaggacttcctggcctggaaggaccccatgtgggccgccctcgctgag
aagatgggtcttgaagagcgcgaggccgtctacgagcccgtctttagcgtgactgagcgt
gagggactcaccgtcgaatctcccgaagtctacctcggcgagcccaacaagatgcacctg
gagggcaccgccaagggacccttcaacgctcacaacccatacattgcccccattgtcaaa
tcgtatgagcttttcaacgtcaaggatcgcaattgtctgcacatcgacgtcgacgtcagt
ggctctaacctgacgtaccagaccggtgaccacatcgcagtctggcctactaacccgggc
gaggaggtcgactgcctcctcgatgtgcttgggcttacggacaagcgtgacaccgtagtc
agcgtcaggcctcttgagccaaccgcaaaggttcccttccccgcacctacgacgtacgat
gccattctccgctaccacatggagatatgtgctccggtctcgcgtcaattcattgccaca
ctggccgcctttgcgcccgatgaggaaaccaaggcggagatgaccaagctcggcggtgac
aaggactacttctcagcaaagatcagcaagcactacctcaacatcgcacgagtacttttc
aatgttggcaagggcaagaagtggaacaacattcctttctccgctttcatcgaaggtctc
acaaagttgcagcccaggtactactcgatttcgtcctcctcgttggttcagcccaaggtc
atcaccattactgctgttgtagagaagcaggagattcctggccgcgacgatccattccgc
ggtgttactaccaactacctcttggccctcaagcagaagcaaaatggagaaccccaccca
gagccgtttggtcgcacatttgcgctcgcgggacccagggacaagtacgatggaatcaaa
gttcccgtccacgtccgccattccaacttcaagctgccctcagactcgacgaagcccatc
atccttgttggaccgggaactggcgtggctccgatgagggcttttgtccaggaacgcgcc
aagcaagccgagaacggcgaagaagttggaaagacgatattgttctttggctgccgaaag
tctaccgaggactttttgtacaaggatgagtgggatgaatacaagaaggttcttggcgac
aagttcgagcttgtcaccgctttttcgagagagggtcccaagaaagtctacgtccagcac
cgcctgaaggagagggctcaagagatcaacgagctcttgaccaagaaggcttacatctac
gtctgcggtgatgcggccaacatggctcgcgaggtcaactctgtcctgggacagataata
gcggagcagcgtggcattccggaggccaaggccgaggaaatcgtcaagaacatgagggcg
gcaaaccagtaccaggaggacgtctggtcctaa

DBGET integrated database retrieval system