KEGG   Magnaporthe oryzae: MGG_07124Help
Entry
MGG_07124         CDS       T01027                                 

Definition
(RefSeq) replication protein A 32 kDa subunit
  KO
K10739  
replication factor A2
Organism
mgr  Magnaporthe oryzae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MGG_07124
   03420 Nucleotide excision repair
    MGG_07124
   03430 Mismatch repair
    MGG_07124
   03440 Homologous recombination
    MGG_07124
DNA replication proteins [BR:mgr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    MGG_07124
DNA repair and recombination proteins [BR:mgr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     MGG_07124
   MMR (mismatch exicision repair)
     MGG_07124
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     MGG_07124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 275 aa AA seqDB search
MTSYGGNNFSRTGYNAQGAEDGGGFMGGSQQGSQGGPGGKSYQDECLKPVTVKQLLDVQA
PYPDADFLLDGRAITQITLVGQVRSINPQPTNITYRIDDGTGTIDVKRWIDPEKAEDADA
ASQHQPDSYVRVWGKLKAFNNRRHVGALFVRPVEDFNEVNYHMLEVAYVHLDAVRQSSGG
GGGAGGGGDDNMFVDSYGGGGGGGGSKAANCSTNAQRLFNHLQNSSAGNEGLEANIIARG
INMSVRDVEAAADELLSAGLIYPTVDDHTWATLDY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatacggaggcaacaatttctcaaggacgggctataacgcccaaggcgccgag
gatggaggcggcttcatgggaggctcgcaacagggctctcagggaggtccaggaggcaag
agctaccaagacgagtgcctcaagcccgtgaccgtcaagcagctcctcgacgtacaagcc
ccgtacccggacgccgactttctcctcgacggccgcgccatcacacagatcaccctggta
ggacaggtccgatccatcaacccgcagccaaccaacatcacgtaccggatcgacgacggc
acgggcacaatcgacgtcaagaggtggatcgacccggagaaggccgaggatgccgacgcg
gcctcgcagcaccagcctgacagctacgtccgcgtctggggcaagctcaaggccttcaac
aaccgccgccacgtcggcgccctctttgtgcgtcccgtcgaggacttcaacgaggtcaac
taccacatgctcgaggtcgcctatgttcatctcgatgccgtcaggcaaagcagtggaggc
ggtggcggtgctggcggcggtggcgacgataatatgttcgtcgacagctacggtggaggc
ggtggcggcggtggctcaaaggctgcaaactgctccaccaacgcccagcggctattcaac
cacctccagaactcatctgctggtaacgaaggcttggaggccaacatcatcgccaggggt
attaacatgtcggtgagggatgtcgaggctgctgcggatgagctcttgtcggccggtctt
atatacccgacagtcgatgaccatacatgggctaccttggactactaa

DBGET integrated database retrieval system