KEGG   Magnaporthe oryzae: MGG_07124Help
Entry
MGG_07124         CDS       T01027                                 

Definition
replication protein A 32 kDa subunit
Orthology
K10739  
replication factor A2
Organism
mgr  Magnaporthe oryzae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:mgr03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mgr03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mgr03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mgr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 275 aa AA seqDB search
MTSYGGNNFSRTGYNAQGAEDGGGFMGGSQQGSQGGPGGKSYQDECLKPVTVKQLLDVQA
PYPDADFLLDGRAITQITLVGQVRSINPQPTNITYRIDDGTGTIDVKRWIDPEKAEDADA
ASQHQPDSYVRVWGKLKAFNNRRHVGALFVRPVEDFNEVNYHMLEVAYVHLDAVRQSSGG
GGGAGGGGDDNMFVDSYGGGGGGGGSKAANCSTNAQRLFNHLQNSSAGNEGLEANIIARG
INMSVRDVEAAADELLSAGLIYPTVDDHTWATLDY
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacatcatacggaggcaacaatttctcaaggacgggctataacgcccaaggcgccgag
gatggaggcggcttcatgggaggctcgcaacagggctctcagggaggtccaggaggcaag
agctaccaagacgagtgcctcaagcccgtgaccgtcaagcagctcctcgacgtacaagcc
ccgtacccggacgccgactttctcctcgacggccgcgccatcacacagatcaccctggta
ggacaggtccgatccatcaacccgcagccaaccaacatcacgtaccggatcgacgacggc
acgggcacaatcgacgtcaagaggtggatcgacccggagaaggccgaggatgccgacgcg
gcctcgcagcaccagcctgacagctacgtccgcgtctggggcaagctcaaggccttcaac
aaccgccgccacgtcggcgccctctttgtgcgtcccgtcgaggacttcaacgaggtcaac
taccacatgctcgaggtcgcctatgttcatctcgatgccgtcaggcaaagcagtggaggc
ggtggcggtgctggcggcggtggcgacgataatatgttcgtcgacagctacggtggaggc
ggtggcggcggtggctcaaaggctgcaaactgctccaccaacgcccagcggctattcaac
cacctccagaactcatctgctggtaacgaaggcttggaggccaacatcatcgccaggggt
attaacatgtcggtgagggatgtcgaggctgctgcggatgagctcttgtcggccggtctt
atatacccgacagtcgatgaccatacatgggctaccttggactactaa

DBGET integrated database retrieval system