KEGG   Magnaporthe oryzae: MGG_07161Help
Entry
MGG_07161         CDS       T01027                                 

Definition
kinase isozyme 4
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     MGG_07161
Protein kinases [BR:mgr01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [Table]
   MGG_07161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 437 aa AA seqDB search
MSWKKSERLMDTIRHYAKFPATGVSLRQMVQFGEKPSVGTLFRASQFLAEELPIRLAHRV
HELDTLPDGLNEMPSVKKVLDWYAQSFEEITQLPRPELDKSVKERLLKPGRSRTQQLLSE
ATPNPSIAEGQYASQAVTSQNGNGWTKKQHAARRYFAMVDDYGDWPPELQLYNQRFSQTL
NKIKRRHDGVVTTMAQGILEYKRQRQRMQIDNNMQSFLDRFYMSRIGIRMLIGQHIALTD
QSHYRDPTYVGIICTKTNVRDLAQEAIENARFVCEDHYGLFEAPKIQLVCNPNINFMYVP
GHLSHMLFETLKNSLRAVVETHGQDKQEFPVTKVIVAEGKEDITIKITDEGGGIPRSAIP
LVWTYMYTTVDSTPNLDPDFDKSDFKAPMAGFGYGLPISRLYARYFGGDLKLISMEGYGT
DVYLHLNRLSSSSEPLQ
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggaagaagtcggagaggttgatggacaccatcaggcattatgccaagttccct
gcgaccggcgtgagcttgcgccagatggttcagttcggcgagaagccgtctgtaggcaca
ctgttccgggcctcacagttccttgcagaggagctcccaatacgtctggcgcatcgcgtg
cacgagttagataccttaccagatggcctgaacgagatgccctcagtaaagaaggtgctg
gactggtatgcgcagtcgttcgaggaaatcacacaactgccaaggccagaactcgacaaa
tctgtaaaagaaagattattgaagcctggaaggagtaggacccaacagctactgtccgaa
gcgacaccaaaccctagcatagcagaaggccagtatgcctcacaggcggtgacatcacag
aacggcaacggttggaccaagaagcagcatgctgccaggagatactttgccatggtggac
gattatggtgactggccaccagagctgcaattgtacaaccaaaggttttcccagactctt
aacaagatcaagaggcggcacgacggtgttgtgacaaccatggcgcagggtatcctcgaa
tataagcggcagagacagcgaatgcagatcgacaacaacatgcaatcattcctcgaccga
ttctacatgtctcgtatcggcatccgcatgctcattggccaacacattgcccttacggac
cagtcacactatcgcgacccaacttacgtcggcatcatatgcacaaagaccaacgttcgc
gacctggcgcaggaggctattgaaaacgcccgtttcgtctgcgaggaccactacggcttg
ttcgaggcacccaagatccagctcgtctgcaacccgaatatcaacttcatgtacgtgccg
ggccacctgtcgcacatgctgttcgagacccttaagaattccctgcgtgccgttgtcgag
acgcacggccaggacaagcaggagttccccgttaccaaggtcattgtcgcagagggcaag
gaggacattacgatcaagatcaccgacgaaggtggtggcatcccgaggagtgccataccg
ctcgtctggacgtatatgtacacgactgtcgatagcacgcctaatctggaccctgacttc
gacaagagcgacttcaaggcaccgatggctgggtttggatatggtctgccgatctcaagg
ctatacgcgaggtactttggtggtgacctgaagcttatctctatggaaggatacggcacc
gatgtctacttgcacctcaacaggctgtcgagttcctctgagcctttgcaatag

DBGET integrated database retrieval system