KEGG   Magnaporthe oryzae: MGG_07190Help
Entry
MGG_07190         CDS       T01027                                 

Definition
dolichyl-phosphate-mannose-protein mannosyltransferase 2
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
mgr  Magnaporthe oryzae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:mgr00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 743 aa AA seqDB search
MAADNAAVHASGADQGELRRRNVPSTEPIAGTVERVEPDDKKKQVIKHEASFLQVLDEWE
FLIAPIIFTALAFFTRLYQIGKSDIVTWDEAHFGKFGSHYISRTYYFDVHPPLGKMLVGL
SGYMAGYNGSFEFKSGEKYPDWVNYTFMRQFNAFFGAIIVPFAYLTAKELKFKRPAVWLV
TLMVLCENSYTTISRFILLDSMLLCGTVTTVFCWAKFHRLQNKSFEPEWFFWLFMTGLSI
GCVTSVKLVGLFVTALVGLYTIEDLWHKFGNLKMPPLELGAHVAARVVGLIVLPFLVYML
SFAVHFAVLTKTGPGDAQMSSLFQANLQGTEVGKDSPLELAYGSRVTIKNMGYGGGLLHS
HVQTYPEGSTQQQVTCYHHKDSNNDWFFYPNRNDREYKEEEEPRFIADGEVLRLIHVQTG
RNLHSHDIAAPMTKSDKEVSCYGNLTVGDDKDHWKVEVVRDVASRDRSRVRTLTTAFRLK
HASLGCYLRAGNVNLPQWGFKQIEVACTPKNNPRDTYTWWNVEAHWNDKLPKGNPGVYRS
PFIHDFIHLNVAMMTSNNALVPDPDKQDDLASQWWQWPILHVGLRMCGWDDNIVKYFLLG
NPFVYWGTTAGVGVIGLVVVWYLLRWQRGFQDLSMPEVDQIHYSGVYPVIGWFLHYLPFV
VMARVTYVHHYYPALYFAILTFGFLVDWFTRDMHKSIQYGIYTALYTIIIGLYILFMPIC
WGMVGSNKTYSYLKWFDTWRMSD
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atggccgcggataacgcggcggtccacgcctctggcgctgaccagggcgagttgaggcgg
cgcaatgtccctagcaccgagccgatcgcggggacagtcgagagggtcgagcccgacgac
aagaagaagcaggtcatcaagcatgaagcatctttcttgcaggttctcgacgagtgggaa
ttcctcattgcgcccatcatcttcacggccctcgcattttttacgcgactctaccagatt
ggcaagtccgacatcgtgacttgggacgaggcccactttggcaagttcggatcacactac
atatccaggacgtactacttcgatgtgcacccgccgctgggaaagatgctggttggcctc
tcgggctacatggcagggtacaatggctcctttgaattcaagtcgggagagaaataccct
gactgggtcaactatactttcatgcgccagttcaacgccttcttcggtgccattattgtc
ccgtttgcctacctgaccgccaaggagctcaaattcaagcgcccagctgtgtggctggtg
accttgatggttctttgcgagaacagctacaccaccatctcaaggtttatcctcctcgat
tcgatgttactctgcggtaccgttaccaccgtgttctgctgggccaagttccatcgtctc
cagaacaagagctttgagcctgagtggttcttctggcttttcatgactggtcttagcatt
ggctgcgtcacaagcgtcaagctggttggtctcttcgtcactgccctcgtcggtctctac
actatcgaggatctgtggcataagtttggaaacctcaagatgccgccgctggagcttggc
gcacacgttgctgctagggtagtcggactcatcgttcttcccttcctggtctacatgctg
agctttgctgtccactttgccgttctcaccaagacgggtcccggagatgcccagatgagc
tccctcttccaggccaacttgcagggaacagaggttggcaaggacagccccctggagctt
gcctatggcagccgcgtcaccatcaagaacatgggttatggcggtggtctccttcacagt
cacgttcagacataccccgagggctcaacccaacagcaggtcacttgctaccaccacaag
gactccaacaacgattggttcttttaccctaaccgtaacgaccgcgagtacaaggaggag
gaggaaccccgcttcattgccgacggtgaggttttacgcctgatccacgttcagactggc
cgcaaccttcactcgcacgacattgccgcgcccatgaccaagtcggacaaggaggtctcc
tgttatggcaacctgacagtcggtgacgacaaggatcactggaaggtcgaagttgtccgc
gatgttgcttcacgtgaccgcagcagagtcaggactctcactactgctttcagactgaag
catgcttctctgggctgctacctgcgtgctggcaatgtcaacctccctcagtggggtttc
aagcagatcgaggtggcctgtacccccaagaacaaccctcgcgatacttacacctggtgg
aacgtcgaggcacactggaacgacaagctgcccaagggaaaccccggtgtttacaggtcg
ccgtttatccatgacttcatccacctcaacgttgccatgatgacgtccaacaacgctctt
gtccctgaccctgacaagcaggacgatcttgcctcgcaatggtggcagtggcctatcctc
catgtcggtctgcgcatgtgtggatgggacgacaacatcgtcaagtacttcctcttgggc
aaccccttcgtttactggggtaccactgccggtgtgggagtcattggcctggttgttgtc
tggtacctgctccgctggcagcgtggattccaggatctctcgatgcccgaagttgaccag
atacactactcgggtgtctatcccgtcattggatggttcttgcactacctgcctttcgtc
gtcatggcgcgtgtgacctacgtgcaccactactacccggcgctctactttgccatcctg
acgttcggcttcctcgtcgactggtttactcgcgacatgcacaagtctatccagtacggc
atctacactgcgctctacacgatcatcatcggtctttacattctgttcatgccgatctgt
tggggtatggttgggtcaaacaagacctacagctacctcaaatggttcgacacatggaga
atgtctgattaa

DBGET integrated database retrieval system