KEGG   Magnaporthe oryzae: MGG_07287Help
Entry
MGG_07287         CDS       T01027                                 

Definition
lysophospholipase Plb3
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MGG_07287
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MGG_07287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 674 aa AA seqDB search
MRFLHLLSILAAASANATPVEIQQQREPQLEGETIERRALPDSPSGGYAPVSDSCPSNRP
TVRSAATGISPDEASWLPNRRKNTVKPMSDFLTRANIQGFNAADYISKFQSNMTALPNIA
LAFSGGGYRALLNGAGFIKAADERTPGTTGPGGIGGLLQSATYMSGLSGGSWLLGSVFNN
NFSSIGDLQQNPNVWKFDRTIFVGPKTSRSSVKKLIDSAAYWKDIIGEVEGKSKAGFLTS
ITDYWGRALSYQLIDDVDGGDQYLFSSIAQTSDFQAGNYPMPMIVANGRKPDSVIISLNS
TVFEFNPFEMGTWDPTTSGFAPLQYVGSNFEGGVVPSSGKCVRGFDQSSFVMGTSSSLFN
AILLRIEQNNTGSQNPAVPETVAKLIKALGPKIQAENRDVASWKPNPFFGFHPDTAGGIA
SSAELSLVDGGLDGQNIPLLPLIQPVRKVDVIYAIDSSADTSTSFPNGSAILHTFQRSQS
QMGNGVQFPAVPDVNTFVNLGLNNRPVFFGCDVNAFKGPQPPPLVVYMPNAPYSAFSNST
TFTMKYEENRRDAIIANAFDGATQGLGSLDKEWPACVACAALQRSMLRTNTQIPTQCQSC
FTRYCWDGKTDTTPRGKDFYQPTLKLTNGGSQPPQADIGGQPKKKSISGKLLVPSSSAMM
AGSLALVTIIFAML
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttccttcatctactctcaatactcgccgcggcgtcggcaaacgcgacacccgtc
gagatacagcaacagcgagaaccacaattagaaggagagacgatagaacgtcgagccctg
ccagactcgccatcgggaggatatgcgccagtttcggactcatgccccagcaatcggccg
acggtgaggagcgcggcgactggtatcagtcccgatgaggcatcatggctgcccaaccgg
cgcaagaacactgtcaaacccatgtccgacttcctgacccgggcgaacatccagggcttc
aacgccgccgactatatttcgaaattccagagcaatatgaccgcgctaccaaatattgcc
ctggctttcagcggaggtggatatcgagccttgttgaacggtgctggatttatcaaggct
gccgacgagaggacaccagggacaaccggaccaggcggaattggtgggcttttgcaatct
gcgacatacatgtcgggcctgtccggaggtagctggcttcttgggtccgtctttaacaac
aacttctcgtccatcggtgacctgcaacagaacccgaacgtgtggaagtttgaccgtacc
atctttgtaggcccaaagacgagccgcagctctgtaaagaagctcatcgactcggccgcc
tactggaaggatatcatcggagaggttgagggaaagtcgaaagccggtttccttacttca
atcaccgattactggggccgggctctttcgtaccagctcatcgacgacgtggacggcgga
gaccagtacctgttctcatccatcgcgcagacttccgacttccaggcgggcaactatccc
atgcccatgatcgtcgccaatggccgcaagcccgactctgtcatcatctcgctcaactca
accgtgtttgagttcaaccccttcgagatgggcacctgggatcccaccacctctggcttt
gcacctcttcagtacgttggatccaactttgagggtggcgtcgtcccgtccagcggcaaa
tgtgtgcgcggcttcgaccagtcgtcttttgtcatgggtaccagctcctcgctcttcaac
gccatcctgctccgcatcgagcagaacaacacgggcagtcagaaccccgctgttccagag
accgtcgccaagctcatcaaggccctcggccccaaaatccaggccgagaacagggacgtg
gcttcttggaagccaaacccctttttcggcttccatcccgatacggccggcggcatcgcc
tcgtccgccgagttgtccctggttgacggcggcttggacggacagaacatccccctgttg
cccctgatccagccggtacgcaaggtcgacgtcatctacgccatcgattcatcggccgac
accagcaccagcttccccaacggcagcgccatcctccacaccttccagcgctcccagagc
cagatgggcaacggggtgcagttccccgcggtcccggacgtcaacacctttgtcaacctc
ggcctcaacaaccgcccggtcttttttggctgcgacgtcaacgccttcaaggggccccag
cccccgcccttggtcgtctacatgcccaacgcgccctactcggccttttccaactcgacg
acctttaccatgaagtacgaggagaatcgccgagacgcgatcatcgccaacgcctttgac
ggcgccacccaggggcttggcagcctcgacaaggagtggcccgcctgcgtcgcctgcgcg
gccctgcagcgcagcatgctccggacaaacacccagatcccgacccagtgccagtcttgc
ttcacccgctactgctgggacggcaagaccgacaccaccccgcgcggcaaggatttctat
cagcccacgctcaagctcacgaacggaggatcgcagccgccccaagctgacataggaggc
cagccaaagaagaagtcgatatccggtaagctactagtgccttcgagcagcgccatgatg
gcaggctccctcgctctcgtgaccatcatttttgccatgctctag

DBGET integrated database retrieval system