KEGG   Magnaporthe oryzae: MGG_07289Help
Entry
MGG_07289         CDS       T01027                                 

Definition
glycogen synthase
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mgr  Magnaporthe oryzae
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGG_07289
Enzymes [BR:mgr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MGG_07289
Glycosyltransferases [BR:mgr01003]
 Polysaccharide
  Storage polysaccharide
   MGG_07289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 708 aa AA seqDB search
MAEGGEREPREVKNHILFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHTS
AAVEVEELEPKDPALTATIQSMKDRGIGILYGRWLIEGAPRVLLIDTKTAYKHLDEWKTD
LWNVASIPSPPGDDETNEAIVFGYLVAWFLGEYVCHEKKKAVIAHFHEWLAGVGLPLCKK
RRIDVTTIFTTHATLLGRYLCAGSVDFYNNLQWFDVDAEAGKRGIYHRYCIERAAAHSCD
VFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFAAMHEFQNLHAQSKEKIHDFVRGHFY
GHYDFEPENTLYFFTAGRYEFRNKGCDMFIESLARLNHRLKASGSKTTVVAFVIMPAQTS
SLTVEALRGQAVVKSLRDTVDVIEKSIGRRIFERSLKWHDGDPLPDEKELITSQDRVLLR
RRLFAMKRHGLPPIVTHNMVNDSEDPILNQIRRVQLFNHPTDRVKIVFHPEFLNSANPVL
PLDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDYG
IYIVDRRTKGVDDSVNQLTNCMLEFCQKSRRQRINQRNRTERLSDLLDWKRMGLEYIKAR
QLALRRAYPNSFDGDDTADFMNSSDLKISRPFSVPGSPRDRAGMMTPGDFASLQEGREGL
STEDYVSWKLPEEEDPDEYTFPLTLGAKQRPSGPASPLDGVHLNGNGN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggagaacgcgagcctcgcgaggtcaagaaccacatcctgtttgagatt
gcaaccgaggttgcgcacagagttggcggtatctactccgtcatcaaatcgaaagctccc
gttacgacggccgaatatggcgaccgctacaccttgattggtccgctcaatcatacttct
gctgctgtcgaagttgaagagctcgaaccgaaggaccctgcgctcactgccacgatccag
tccatgaaggatcgtgggatcggcatattatacggacgatggctgatcgagggtgctccg
cgcgtgctcctgatcgatacaaagactgcttacaagcacctcgacgagtggaagacggat
ctttggaacgtcgcttccattccttcgcctcccggtgacgatgagactaacgaggctatt
gtgtttggttacctggttgcctggttcctaggagagtacgtttgccacgagaagaagaag
gcagtcattgcccatttccacgaatggcttgcgggagttggacttccactgtgcaaaaag
cgacgcattgatgtcaccaccatcttcaccactcacgccactctgctgggaagatatctt
tgtgccggctccgtcgacttttacaacaacctccagtggtttgatgtggatgctgaagct
ggcaagcgtggtatttaccaccgatactgcatcgagcgtgccgccgcccactcgtgcgat
gtcttcactacagtctcgcacatcactgcttacgaaagcgagcacctgctcaagcgcaag
cctgatggtgttctgcccaacggattaaacgtgaccaagtttgcggccatgcatgagttc
caaaatctccacgcccagtccaaggaaaagatccacgactttgttaggggccacttctac
ggccactatgactttgagcccgagaacactctctacttcttcacggctggtcgctacgag
ttcaggaacaagggctgtgacatgttcattgagtctctggcgagacttaatcaccgtctc
aaagcctctggaagtaagactactgtcgtggcttttgtcatcatgcctgcccagacctcc
tcccttacagtggaggccctgaggggtcaggccgtggtcaagtctctccgagacacagtc
gatgtgattgagaagagcattggtcgcaggatctttgagcgctctttgaagtggcacgat
ggcgaccctctccccgatgagaaggagctgattactagccaggaccgtgtcctgctccgg
agacgtctgtttgccatgaagcgccacgggcttccgcccattgtcacccacaacatggtg
aatgactctgaggatcccattctcaaccaaattcgtcgtgtccagctgttcaaccaccca
acagatcgcgtcaagattgttttccacccagaattcctcaactcggccaaccctgtgctg
cccctggattacgacgattttgtccgtggaacccatctcggtgtctttgcatcctactat
gagccgtggggttacaccccggccgagtgcaccgtcatgggtgttccgtcgatcacgacc
aacctgtcgggcttcggttgctacatggaggagctgatcgaaaactctagcgactatggt
atttacatcgtagaccgcaggaccaagggtgtcgacgactcggtcaaccagctcaccaac
tgcatgttggaattttgccaaaagagccgcaggcagcgcatcaaccaacgcaaccgtacc
gagcggcttagcgacctccttgactggaagcgaatgggacttgagtacatcaaggcgcgc
cagcttgcgctccgtcgggcctacccgaactcattcgatggtgacgacacagccgatttc
atgaacagcagcgacttgaagatctcgcgtcccttctcggtccccggatctcctcgtgac
cgggctggcatgatgacgcctggtgactttgccagtctgcaggagggcagggagggactc
agcactgaggactacgtatcgtggaagcttccagaggaggaagaccccgatgagtacacc
ttccccctgaccctgggggcaaagcagcggccttccggccccgccagcccgcttgacggc
gtgcatctcaacggcaacggtaactag

DBGET integrated database retrieval system