KEGG   Magnaporthe oryzae: MGG_07393Help
Entry
MGG_07393         CDS       T01027                                 

Definition
histone-lysine N-methyltransferase SET9
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
mgr  Magnaporthe oryzae
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    MGG_07393
Enzymes [BR:mgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     MGG_07393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 885 aa AA seqDB search
MPPKSAKKQPLTFAQLAAYDDILTDALVDHTFYWTTIPKNRPSYHASRGVKQDEVTKIVK
DHVILQPNVKLAEEKMLATDGLKRFCNGLKTPKEKDDFRAHLRRYLSIYLPDCPFEVNST
NRYTIFTHEASVTARRPIRKNEIIKALCGIQVVISPAEEAEIAKRKKDFSIVISSRSKST
SLFMGPARFANHDCGANARLKTADQSIMEVQALRNIEVGEEITVTYGDNYFGEDNCECLC
RTCELGRVNGWAGDEGDGNGGFEKSIEEDQGTPAGYSLRRRRRDGSTSRAMSRDSSVTPD
LRPRIRKTRSKAQLNTSDRASTVDSEASGNQTAKRKRELDTLASPPFTPAKRQKIASGLS
EMMTADLLPPASMSTPPESSVGQLSRQSSVFERGTSEQLVESSDVTTPEHDSSESSTPPP
KSDVDEDGSQPVAPALAATRDGSQGLIQKPSLKGISCAGTSTTTLSSSRAVELYSPSDVM
LMPQSRPSTREKLTRSQVADESADATVVKAEVSETSTITVVNSVEGDSTSVIAGEVARIS
GKIASSSETDTKSESSTASPCDTTLDSGAISRSKKARQDDKDEPSQRGQSKKRMPGDYTL
TPVLLSEPMTAWVHCSNCATAFVQRDAYYTRANCPRCERHSILYGYVWPKTEPEGSDDDE
ERVLDHRTVHRFLDPEDEAKVRGRKLSAWLVNKKLAEAKAAEVAEAAKNKKKQPSKVVKK
VASKTTITAATKVKKAASTASVFGRVTKAGSGVSEGLKTSKTSPVTLSKKSANSEVDHGE
AVGDSITSSASSAADSADCTTQMAIAQQLGAYVDTKFGLDDEGMSDQGDVDHCAKGKIDE
RKQSSVLQQRRLSLDSAGNRRRSGRACKASAKATAAAALATVGSD
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaaatctgccaagaagcaacctctgacgtttgcccaattggcggcctacgat
gacatactgacagatgcgctggtcgaccacacgttctactggacgacgattccaaagaac
cgaccatcgtatcatgcctcccgcggagtcaagcaagatgaagtcaccaagatagtgaag
gaccatgtaattctccagccaaacgtcaagctggccgaggagaagatgctggccacggac
gggctaaaacggttctgcaatggacttaaaacgcccaaggaaaaggacgactttcgcgcg
cacctacgccgttacctttccatctacctacccgattgccctttcgaggttaactcgacc
aaccgatacaccatcttcacgcacgaggccagtgtcaccgcgcgacgcccgatcaggaag
aacgagattattaaggccttgtgcggaattcaagtcgtaatctcgcctgcggaggaagcc
gaaatcgccaagcgcaagaaggacttctcgattgtgattagctcgcgtagcaaaagcacg
agcctgttcatgggccctgcacgcttcgcgaaccacgactgcggtgccaacgccaggctg
aagacggctgaccagtccatcatggaggtccaggcgcttcgaaacatcgaagtgggcgaa
gaaataacggtcacgtacggcgataattactttggagaggataattgcgaatgtctgtgc
aggacgtgcgaactcggcagggtgaatggttgggcaggtgacgagggcgatggaaatggc
ggctttgagaagagcatcgaggaggatcagggcactcccgcagggtattcactacggcgg
agaaggcgcgacggcagcaccagccgcgcaatgtctagggattcatcagtcacgcccgac
ctgcgaccgcgaattcggaagacacggtccaaggcgcagctgaatacctcggacagggct
tccaccgttgactcggaggcgtctgggaaccagactgcgaaacggaaacgcgaactggat
acactggccagtccaccattcacgccggcgaagagacaaaagatcgcgagcgggctttcc
gagatgatgacggcagatttgctacctcctgcgagcatgagcactcccccggagagctca
gtcggacagctcagcagacagtcatccgtgttcgagagaggaacgtcggaacaacttgtt
gaatcatccgacgtcacaacaccagagcatgacagctccgaatcgagcacaccccctcca
aagtcagatgtggacgaggatggttcgcagccagtggccccggcattggcggcaactaga
gatggtagccaagggcttatacaaaaaccttcgttgaagggtatctcttgtgcaggaacc
agcacgactactctaagctcatcgcgggcagtggagctttattcaccgtcggatgtgatg
ctcatgccacaatcgagacccagcactcgagaaaaattaactaggtcgcaggttgccgac
gaatctgccgacgcgaccgttgtaaaggctgaggtgtctgaaacaagtaccatcacggtc
gtcaacagtgtcgaaggcgattctacctcggtcattgctggtgaggtagcacgaatttcg
ggtaagattgcctcgtcttccgagacagacaccaaatcagagtcctccaccgcaagtcca
tgcgatacgactttggacagcggggcaatttccaggtccaagaaggctaggcaagacgac
aaagacgaaccttctcaacgagggcaaagcaagaaacgtatgccgggcgactacacactg
acacctgtccttctgtcggagccaatgacggcttgggtgcactgctccaactgcgcgacg
gcttttgtgcagcgcgatgcgtattacacgcgggcaaactgtccacgctgcgaacgccac
agtattttgtacggttacgtgtggcccaagacggaacccgaggggtctgacgatgacgag
gagcgcgttctcgaccaccgaacagtccatcgtttcttggaccccgaggacgaagccaag
gtgcgggggagaaagcttagtgcgtggcttgtcaacaagaagctcgccgaagccaaagcg
gccgaggttgctgaggcggcaaagaacaagaagaagcagccgtcaaaggttgtcaagaag
gtggcgtcaaagacgacaattacagctgcgacaaaggtcaagaaggcggcatcaacggct
tctgtgtttggcagggtcaccaaggcgggttctggcgtttctgaaggcctcaagaccagc
aagacgagtcctgtaactctatcaaagaagtcggccaattcagaggtcgaccatggagag
gctgttggcgattccatcacatcatcggcctcatccgcagcggacagcgccgactgtacg
actcagatggctatagcgcaacagctcggggcatacgtcgacactaagtttggccttgat
gacgaaggaatgtctgatcagggagatgttgatcattgtgctaagggcaagatcgacgag
cgcaagcagtcttcagttcttcagcagaggcgactatcgttggattctgctggcaacagg
cggcgcagcggccgggcttgtaaggcttcagccaaggccactgctgctgctgcattagct
actgtcgggtctgattga

DBGET integrated database retrieval system