KEGG   Magnaporthe oryzae: MGG_07460Help
Entry
MGG_07460         CDS       T01027                                 

Definition
peroxiredoxin HYR1
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mgr  Magnaporthe oryzae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mgr00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mgr00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 172 aa AA seqDB search
MASATTIYDFKPLNKKGEETPLADYKGKVVLVVNTASKCGFTPQYAGLEALYKKITEKHP
EDFTILGFPCNQFGGQEPGTDDDIQNFCQVNYGVTFPIMKKVDVNGDNADPLFKWLKEEM
PGIMGLKRVKWNFEKFLIGRDGKVKGRWASTTKPESLEKDILKEIEAPKPSI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctacgacaatctacgacttcaagcccctcaacaagaagggcgaggagacc
cctctggccgactacaagggcaaggtcgtcctggtagtcaacacggcctccaagtgcggc
ttcacgccgcagtacgccggcctcgaggccctgtacaagaagatcaccgagaagcacccc
gaggactttaccatcctcggcttcccctgcaaccagtttggcggccaggagcccggcacc
gacgacgacattcaaaacttttgccaggtcaactacggcgtcaccttccccatcatgaag
aaggtcgacgtcaacggcgacaacgccgacccgctcttcaagtggctcaaggaggagatg
cccggcatcatgggcctcaagcgcgtcaagtggaactttgaaaagttcctgattggcagg
gacggcaaggtcaagggccgctgggcgagcacgaccaagcccgagtcgctcgagaaggac
attctcaaggagattgaggctcccaagccgtccatctaa

DBGET integrated database retrieval system