KEGG   Magnaporthe oryzae: MGG_07460Help
Entry
MGG_07460         CDS       T01027                                 

Definition
(RefSeq) peroxiredoxin HYR1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00480  Glutathione metabolism
mgr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MGG_07460
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MGG_07460
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MGG_07460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA DUF4174 Redoxin
Motif
Other DBs
NCBI-GeneID: 2683380
NCBI-ProteinID: XP_003711364
UniProt: G4N178
Position
3
AA seq 172 aa AA seqDB search
MASATTIYDFKPLNKKGEETPLADYKGKVVLVVNTASKCGFTPQYAGLEALYKKITEKHP
EDFTILGFPCNQFGGQEPGTDDDIQNFCQVNYGVTFPIMKKVDVNGDNADPLFKWLKEEM
PGIMGLKRVKWNFEKFLIGRDGKVKGRWASTTKPESLEKDILKEIEAPKPSI
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgctacgacaatctacgacttcaagcccctcaacaagaagggcgaggagacc
cctctggccgactacaagggcaaggtcgtcctggtagtcaacacggcctccaagtgcggc
ttcacgccgcagtacgccggcctcgaggccctgtacaagaagatcaccgagaagcacccc
gaggactttaccatcctcggcttcccctgcaaccagtttggcggccaggagcccggcacc
gacgacgacattcaaaacttttgccaggtcaactacggcgtcaccttccccatcatgaag
aaggtcgacgtcaacggcgacaacgccgacccgctcttcaagtggctcaaggaggagatg
cccggcatcatgggcctcaagcgcgtcaagtggaactttgaaaagttcctgattggcagg
gacggcaaggtcaagggccgctgggcgagcacgaccaagcccgagtcgctcgagaaggac
attctcaaggagattgaggctcccaagccgtccatctaa

DBGET integrated database retrieval system