KEGG   Magnaporthe oryzae: MGG_07468Help
Entry
MGG_07468         CDS       T01027                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase
  KO
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.4.19.12]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     MGG_07468
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGG_07468
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1175 aa AA seqDB search
MQDPDSPNAMMVDPIDNATHVVDVNGPLERDSVTEITPDTLADDAEPTSPMPLATDFEAI
KELVMTPLQEEPKVLEDAYNTWTVENWRSLSKKEHGPIFQAGGFPWRILLFPHGNNTSNV
AIYLEHGFEPDKIPEDWSCCVQFALVLWNPNDPSIYAHHTAHHRFTKDEGDWGFTRFQEL
SKLFNVPYDDATRPLIEDETANITAYVRILEDETGVMWHSFANYDSKKETGYVGLKNQGA
TCYLNSLLQSLYFTNAFRKAIYQIPTEQEESINNSAYTLQRLFYQLQTSSNAVGTAELTK
SFGWETRHIFEQQDVQELSRKLMERMEEKMKGTDAENLLPELFSGKIKTYISCIHVKYES
SRIEDFWDVQLNVSKMGNLLNSFQDYVSVEKMEGENKYFAGDEYKLQEANKGVIFMGFPD
VLHLQLKRFEYDFTKDAMAKVNDRYEFPEVFDAAPYLSEDADRSEPWIYQLHGVLVHSGD
LNAGHYYAFLKPDKDGWFYKYDDDKVTKATKREVLEDNFGGPFQYSNGIRPQGQKKVAMR
PNSAYMLVYFRQSRLDKILTPVTHEDIPRHIETGYLEEASAREAKRKEREEQHLYRWIKA
VTPSSYQAHNGFDLTNFDAVSSQTTDPSPGAPKLYKVLRTATMEQVTEIIAKDLGQDPAR
VRLWLMVGRQNKTVRPDQPIMDLRPTLDETYSRLATQREDSLRLWVEFAEEMGENGEAAW
PTYQGPSPTGVIFKNDLILLFIKCFDAEAQTLTGLGHVYISREKKVDDLIPHILKKMGLE
KLPSDEKILLWEEIKPGMIESLKGKQSLKAAELQDGDIVCVQRKKDAGSQNFLEKRLSSD
TRSTDDTSRKTENFEDAKEYYEFLVNRKTVKFNAHPTKCDPNEYPPFEMVLNSKMTYDQL
AEKLGERLGVPETHLRFWTLHGTTGLPRTAVKRGPQQTLNTILNPAGFSQLNSAQRNDAL
YFEILDMSLAELDTKKNVKITWLSEGIVKEEHYDLLVTKSGVVEDIIESLVKKAKLKSEE
EGGEIRLYEVNGHKFTRELPREYPVISLNDYLTLVAERVPEEEVDAKDQGQFVYAFHFQN
EPNRMHGMPFKFLLKAGEPFSETKKRLEKRTAIRGKNFEKIKFAIVRRSSYSRPQYINDD
DVLWDILQPEDEYLGLDHADRSRSLRNGVGDLFLR
NT seq 3528 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaccccgattctcccaatgccatgatggtggaccctatcgacaatgctacacat
gtcgtcgatgtcaatggcccgctcgagagggactcagtaaccgagatcacgcctgatacc
ctcgccgatgatgctgagccgacgtcacccatgcctttagccaccgactttgaggctatc
aaggagcttgttatgacgccgttgcaggaagagcctaaagtcttagaggatgcctataac
acatggacagtggagaattggagaagcttgtctaagaaggagcacggcccaatatttcaa
gcaggcgggttcccatggcgcattctactcttcccccacggtaacaatacgtcaaacgtc
gcgatatacctcgagcatggtttcgagccggacaagattccagaggactggagctgttgc
gttcagtttgcgcttgtgctttggaaccctaacgatccttccatctatgcgcatcacacg
gcacaccatcgatttaccaaggacgagggtgactggggcttcacgaggtttcaagagctt
agtaaactcttcaacgttccctatgatgacgctacccggccgctgattgaagatgagacg
gccaacatcaccgcatatgtgcgaatcctggaagacgaaactggtgtcatgtggcacagt
ttcgccaactacgactccaagaaagagacgggctatgtcggtctcaagaatcagggcgcc
acatgctacctcaactcgctgttgcagtccctctacttcaccaatgctttccgcaaggcc
atctatcagatacctacagagcaagaagaaagcataaataacagtgcttacactctccag
cgtttattctaccaactgcaaacctcgtcaaacgccgtgggtacagcagagcttaccaaa
tccttcggatgggagacgcggcacatcttcgagcaacaagacgtgcaagagctctccagg
aagctcatggagcgcatggaggagaaaatgaagggaaccgacgccgagaatcttctgcct
gagctcttcagtggcaagatcaaaacttatatctcttgcatacacgtgaaatacgaatcg
agccggatcgaggatttctgggatgtgcagctgaatgtgagcaagatgggcaacctgctt
aacagcttccaggattacgtctctgtcgagaagatggagggtgagaacaagtattttgcc
ggtgacgagtacaaactgcaggaggcaaacaagggcgttattttcatgggtttccccgac
gtcctgcacctgcagctcaagcgttttgagtatgactttaccaaggatgccatggcgaaa
gtcaacgatcgctatgagtttcccgaggtgtttgacgctgccccgtacctctcggaggat
gccgacaggtcggagccttggatttaccagctacatggtgtgcttgtgcatagtggtgac
ctcaatgcaggccattactacgcatttctaaagccggacaaggacggctggttctacaaa
tatgacgatgataaggtcaccaaggcgaccaagagggaggtactcgaggacaattttgga
ggacctttccagtacagcaacggcatccgcccacaaggacagaagaaagttgctatgagg
cccaacagtgcatacatgttggtgtacttccgtcaatctcggcttgacaagattttaacg
ccagtcacgcacgaggatatcccgcgtcacattgaaaccggataccttgaggaggcgtcc
gctagggaggcgaagagaaaggagcgtgaagagcagcacctctaccgctggatcaaagcc
gtcactccgtcttcatatcaagcacataacgggtttgatctgacgaactttgatgcggta
tcctcacaaacaacagacccttcaccgggtgcccccaaactatacaaggtacttcggacg
gcaaccatggaacaagtcactgaaatcattgccaaagatcttgggcaagatcccgcgaga
gtcaggctatggttaatggtcggccgtcaaaacaagacagttcgtcctgaccagcctatc
atggacttgcggccgacattggatgagacctattcaagattagcgactcagagagaggat
tccttgcgactgtgggttgagtttgctgaagagatgggtgaaaatggagaggccgcttgg
ccaacataccaaggcccctcgcccacaggtgttatctttaagaacgacttgatccttctt
ttcatcaagtgttttgacgcagaggcacaaactcttactggtcttggtcatgtgtacatc
agcagggaaaagaaggtggacgacctaatcccccacattcttaagaaaatgggactggag
aagcttcccagtgatgagaagatactcctgtgggaagaaattaaacccggaatgatcgag
agccttaagggaaagcaatcgctcaaagccgccgagcttcaagacggagacatagtgtgt
gtccagcgcaagaaggacgctggttcacaaaacttcctggaaaagaggttaagcagtgac
acccgttcaactgatgacacgtcaagaaagacggagaactttgaggacgcgaaggagtac
tatgaattcttggtcaacaggaaaacggtcaaattcaacgcacatcccacaaagtgtgac
ccgaacgagtacccaccgtttgagatggtcctcaactctaagatgacgtacgaccaactt
gcagagaaattgggcgaacgccttggagttccagagacgcacttgaggttctggactctt
cacggaacaacaggactcccccgaacagcggtcaaacgcggaccgcaacagactctgaat
actattctcaaccctgccggattcagccagttgaactcggcgcagcgcaatgatgccctt
tattttgagattttggatatgagtcttgccgagcttgacacaaagaagaatgttaagatc
acctggctcagcgaaggaatcgtcaaagaggagcactatgatttgcttgtaaccaagagt
ggtgttgttgaggatattatcgagtcgctcgtcaaaaaggccaagcttaagtcagaagaa
gaaggtggcgagatccgtttgtatgaggtcaatggccacaagtttacaagggaacttccg
cgcgagtatccagtcataagcctcaacgactacctaactctggttgccgagcgggtacca
gaggaggaggtggacgccaaggatcagggccaatttgtttatgctttccatttccagaat
gagcccaacaggatgcacggcatgccgttcaaattcctgctcaaagcgggagagccgttc
tcggagaccaagaagaggcttgagaaacggactgctatccgtggtaagaactttgaaaaa
attaagtttgccattgtacgccggtcgtcatactcaaggcctcaatacataaacgatgac
gatgtgttgtgggatatccttcagccggaagacgagtatctgggtctcgatcatgcagac
agatcccgatctttgcgcaacggcgttggcgacctctttttgaggtaa

DBGET integrated database retrieval system