KEGG   Magnaporthe oryzae: MGG_07613Help
Entry
MGG_07613         CDS       T01027                                 

Definition
(RefSeq) acetyl-CoA carboxylase
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mgr  Magnaporthe oryzae
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MGG_07613
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MGG_07613
   00640 Propanoate metabolism
    MGG_07613
  Lipid metabolism
   00061 Fatty acid biosynthesis
    MGG_07613
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    MGG_07613
Enzymes [BR:mgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     MGG_07613
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     MGG_07613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 2344 aa AA seqDB search
MTETNGTAAAANSSRQRNGANGVTVPVANGKATYAQRHKIADHFIGGNRLENAPPSKVKE
WVAAHDGHTVITNVLIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLQANAD
YIRMADHYVEVPGGTNNNNYANVELIVDVAERMNVHAVWAGWGHASENPKLPESLAASPK
KIIFIGPPGSAMRSLGDKISSTIVAQHAQVPCIPWSGTGVDAVQIDKKGIVTVDDDTYAK
GCVTSWQEGLEKARQIGFPVMIKASEGGGGKGIRKAVSEEGFEELYKAAASEIPGSPIFI
MKLAGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFKAMEEAA
VRLGRLVGYVSAGTVEYLYSHADDKFYFLELNPRLQVEHPTTEGVSGVNLPASQLQIAMG
IPLHRISDIRLLYGVDPKLSTEIDFDFKNPDSEKTQRRPSPKGHLTACRITSEDPGEGFK
PSNGVMHELNFRSSSNVWGYFSVGTQGGIHSFSDSQFGHIFAYGENRSASRKHMVIALKE
LSIRGDFRTTVEYLIKLLETEAFEENTITTGWLDELISKKLTAERPDKMLAVVSGAVTKA
HLASEQCLNEYKAGLEKGQVPSKDILKTTFPIEFIYEGERYRFTVTRSSKDSYHLFINGS
NCSVGVRPLSDGGLLILLDGKSHNVYWKEEVGATRISIDNRTCLLEQENDPTQLRTPSPG
KLVKYTVESGDHIKAGQTFAEVEVMKMYMPLVAQEDGTVQLIKQPGSTLEAGDILGILSL
DDPSRVKQAQPFLNKLPEYGNPVITGNKPAQRFTQLHNILDNIMLGYDNTTVMRDSLLQL
IEVMRDPDLPYSEWNSQFSALHTRMPQKLEAQLSHVIDRARARQSEFPAKALKKTFHKFI
DEHVARQDAGLLKTTLAPLVDVLDLYEEGQKAHELKTMSNLIAKFIETEKLFSGRRLQDD
DVILKLRDENKDDIQKVVQTVLSHSRVPTKSLLVLAIIEEYRPNKPDVGNVTKYFRDVLK
KLTELESRLTAKVSIKAREVLIQCSLPSLDERKAQMEHILRSSVVESRYGEAAYDHRFPN
MDVIKEVVDSKYTVFDVLSLFWAHSDKWVSLAALEVYIRRAYRAYDLGKIDYQYDEEDDP
VFVSWDFVMKLSGDVEFGIGGPLQSAAPSSPATPNEFTFNRVTSLSDMSYLAKKTAEQPI
RKGVMVACKFFDDVDDDLPKALESLPMKGKLKRLGSSGPAAAIASQLDNKRRPAAASRDD
DELTAVVNVAIRDAESRDDDETLSRIKPLLASFKEELCARRVRRITFICGKNDASYPAYY
TFRGPNYDEDESIRHSEPALAFQLELDRLSKFKYKSVFTENKNIHVYEAIGRGVDTDKRY
FTRAVIRPGRLRDEIPTAEYLISEADRVVNDIFDALEIIGNNNSDLNHLFLNFIPVFNIH
PGEVEHALAGFLERFGSRGWRLRVSQVEIRIICTDQNSGAKLPIRCYINNTSGFVVKVEL
YHERRNDKGDLILHYISGTSKTGALHLLPANTPYPTKNWLQPKRYKAHLIGTQYVYDFPE
LFRQAIQLSWKKLEAQHSPIASKKPEEGECTHTLELVLDDQDNLQAIEREPGTNTCGMVG
WIITAFTPEYPSGRRFVVVANDITYSIGSFGPKEDHFFNKCTEYAQKLGIPRIYLSANSG
ARLGVANELIPHFKVAWTDPSNPNKGFDYLYLLEEAKKKFEETVITEEITVDGETRHKIV
TIVGAEDGLGVECLRGSGLIAGATSRAYNDIFTCTLVTCRSVGIGAYLVRLGQRAVQIEG
QPIILTGAPALNNLLGREVYTSNLQLGGTQIMYRNGVSHMTANDDMEGIAKIMEWMSFVP
DQRNRPVPIMAPLDKWDREVDFTPPQRQPYDPRWLIAGKEDADGFQSGLFDRGSFVETLG
GWARTVVVGRARLGGIPMGVIAVETRAVENITPADPANADSMEQVTNEAGGVWYPNSAFK
TAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVKYEQPIFVYIPP
HGELRGGSWVVVDPTINSTVMEMYADKEARGGVLEPEGIIGIKYKKEKQLETMARLDPVY
GELKKRMLAVQAAAKDKTGAADKEELEQIKKQMTQREEQLGPIYQQIAIQFADLHDRAGR
MKAKGTIREVIEWKEARRFFYWRVRRRINEEYLIRKMARATAGLSKTTSAKISESARKGY
LRSLAAWTAVPDFDHEDRKVATWYEENTKIVEEKLKALKTDAVASEISALIRGGTWTHEE
VETPSTPSIEKSKAPLEESTEPRSPTGPVPTTENGLSSSWKGVRDVLRTMPVEDRDKILQ
FLKE
NT seq 7035 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacaaatggaaccgctgcggctgctaacagctcccgtcagcgcaacggcgcc
aacggcgtcaccgtgcctgtggccaacggcaaggctacttacgctcagaggcacaagatt
gccgaccactttattggcggcaacaggctagagaatgcccctccgtccaaggtcaaggag
tgggttgccgcacacgacggccacacagtcatcaccaacgtcctgattgccaacaacggt
atcgctgccgtcaaggagattcgatccgtgcgaaaatgggcatacgagacgttcggagac
gaaagggccattcagttcactgtgatggccactcccgaggatttgcaagcaaacgcagac
tacattcgcatggcagaccactacgtcgaggtccctggtggtacaaacaacaacaactat
gcgaacgtcgagttgatcgtcgatgttgcggagcgcatgaacgtgcacgccgtttgggcc
ggttggggacacgcatcggagaacccaaagctccctgagtctctcgctgcctcgcctaag
aaaattattttcatcggccctcccggctccgcgatgcgctcgctcggtgacaagatctct
tctaccattgtcgctcaacatgcccaggtcccatgtatcccctggtcgggaactggtgtt
gatgcggtccaaatcgacaagaagggaattgtcaccgtcgacgacgacacttatgccaaa
ggatgcgtcacttcatggcaggagggtcttgagaaggccagacaaattggtttcccggtc
atgatcaaggcttctgagggtggtggtggcaagggtatccgtaaggctgtctccgaggag
ggcttcgaggagctctacaaggccgctgccagtgaaatccccggttcgcccatcttcatc
atgaagcttgcaggcaacgccaggcatttggaagtgcagcttctcgctgatcagtacggc
aacaacatctccctctttggtcgtgattgttccgtccagcgaaggcaccaaaagattatc
gaggaagctcccgtgaccatcgccaagcccgacacgttcaaggccatggaggaggccgct
gttcgtcttggtcgtcttgtcggttacgtctctgctggtaccgtcgagtacctgtactcg
cacgccgacgacaagttctacttcctggagctcaaccctcgtcttcaggtcgagcatcct
accactgagggtgtcagtggtgtcaacctccccgcttcgcagcttcagattgccatgggt
atccctctccacaggatatctgacattaggctcctttacggtgtggaccccaagctctcg
actgagatcgactttgacttcaagaaccccgacagcgagaagacgcagaggaggccatcg
cccaaaggccaccttactgcctgccgtattacctcagaggaccctggagagggcttcaag
ccgtccaacggtgtcatgcacgagctgaacttccgcagtagttcaaacgtgtggggttac
ttctcagtcggtacgcagggtggaattcacagtttctccgacagtcagttcggtcacatt
ttcgcctatggcgagaaccgatccgcgtcaaggaagcacatggttatcgccttgaaggaa
cttagcattcgtggtgatttccgcaccacggtcgagtacctaatcaagcttctggagacg
gaggctttcgaggagaacaccattaccactggctggctggacgagcttatttcgaagaag
ctcactgcggagaggcccgacaagatgcttgctgttgtgtctggtgctgtcaccaaggcc
cacctggcgagtgaacaatgcctcaacgagtacaaggctggtcttgagaagggacaggtc
ccatctaaggacattctcaagaccacattccctatcgagttcatctacgagggagagcgg
taccgtttcaccgtcacgcgctcgagcaaagacagctaccatctcttcatcaacggttcc
aactgctccgtcggagttcgtcctctcagtgacggtggtctgctgatcttgctcgacggc
aagagtcacaacgtctactggaaggaagaggttggtgccactcgtatttctatcgacaac
aggacctgtcttctggaacaagagaacgaccccactcagctccgcactcccagccccggt
aagctggtcaagtacactgttgagagtggcgaccacatcaaggctggccagacctttgct
gaagtcgaggtcatgaagatgtacatgcctttggtagctcaggaggatggtacagtccag
ctgatcaagcagcctggctcaaccctcgaggctggtgacattctcggtatactctcactc
gacgaccctagccgcgtcaagcaggctcagccgttcctgaacaagcttcctgagtacggt
aaccctgtcatcaccggtaacaagcccgcccagcgcttcacgcagctgcacaacatcctc
gacaacatcatgcttggatacgacaacacaactgtcatgcgcgacagccttctgcagctc
atcgaggtcatgcgtgaccctgacctcccatacagcgagtggaactcacaattctcagcc
cttcacacccgtatgccgcagaagctggaggctcaattgagccatgttattgacagggct
cgggcgcgtcaatcggaattccccgcaaaggccttgaagaagacattccacaagttcatt
gacgagcatgttgcccgccaggatgctggcctgctcaagacgaccctggctcctctcgtc
gacgtgcttgatctttacgaggaaggacagaaggcacacgagctgaagaccatgtccaac
ttgattgccaagttcattgagactgagaaattgttctctggccgccgtctgcaggacgac
gacgttatcctgaagctgcgtgatgagaacaaggatgacattcagaaggttgttcagaca
gtactgtcacacagccgtgtccctaccaagagtcttcttgtccttgccatcatcgaggaa
taccgacccaacaagccggatgttggcaacgtcaccaagtatttccgtgacgtcctgaag
aagctcacggagctcgagtctaggctgaccgccaaggtttctatcaaagcgcgtgaggtc
cttattcaatgctctcttccctcgctcgacgagcgcaaggcgcagatggagcacatcctg
cgttcgtcggtcgttgagtcccgctacggcgaggccgcgtatgaccaccgtttccccaac
atggacgtgattaaggaggttgtcgactccaagtacactgtcttcgacgtattgagtctc
ttctgggcgcacagcgacaagtgggtctcgctggccgcactcgaggtctacattcgccgc
gcataccgtgcgtatgacctgggcaagattgactaccagtacgatgaggaggacgaccct
gtcttcgtcagctgggacttcgtcatgaagctgagcggtgatgtggagtttggaattggc
ggccctctgcagtctgctgctccatcttctccggctaccccgaacgagttcacgttcaac
cgcgtcacttctctcagcgacatgtcatacttggccaaaaagacagctgagcagcccatc
cgcaagggtgtcatggttgcttgcaagttctttgatgatgttgacgacgacctgccgaag
gccttggagagcctgcccatgaagggtaagctcaagaggctgggcagcagcggtcctgcc
gccgccattgcgtctcagctcgacaacaagcgccgaccggcagcagcatcccgtgacgat
gatgagctcacggctgttgtcaatgttgccattcgcgatgccgagagccgtgatgatgac
gaaaccctttcgcgcatcaagccactgcttgctagcttcaaggaggaactttgcgctcgt
cgtgtgcgccgcatcacgttcatctgtggcaagaacgacgcctcgtacccggcgtactac
accttccgtggtcccaactacgacgaagacgagagcattcgtcacagtgagccagctctt
gccttccagcttgagcttgatcgcctgtcgaagttcaagtacaagtcggtgttcaccgag
aacaagaacatccacgtgtacgaggctattggccgtggcgttgatactgacaagcgctac
ttcacacgtgcggtgattcggccaggtcgtctccgtgacgagatccccacggctgagtac
ctgatctccgaggccgacagagtggttaatgacatcttcgatgctcttgaaatcatcggc
aacaacaactctgatcttaaccacctcttcctcaacttcatccccgttttcaacatccac
cccggcgaggttgagcatgctttggctggtttcttggagcgctttggctcgcgcggctgg
cgccttcgtgtgtcccaggtcgagatcaggattatctgcactgatcagaacagcggcgct
aagctcccgatccgctgctacatcaacaacacctctggttttgttgtcaaggtcgagctg
taccacgagcgcaggaatgacaagggcgacttgatccttcactacatctcgggcactagc
aagactggtgctctccacttgctccctgccaacaccccgtaccctaccaagaactggctg
cagcccaagcgatacaaggcgcacctcatcggtacccagtacgtgtacgacttccccgag
ctgttcagacaagccattcagctcagctggaagaagctcgaggcgcagcactcgcccatc
gcctccaagaagccggaggaaggtgaatgcacccacaccctggagcttgtcctcgacgac
caagacaacctgcaagcgatcgagcgtgagcctggtaccaacacctgcggaatggtgggc
tggatcatcactgccttcacacccgagtaccccagcggtcgtcgcttcgtggttgtcgcc
aacgacattacctacagcatcggatctttcggacccaaggaagaccacttcttcaacaag
tgcacggaatatgcccagaagctcggcattcctcgcatctacctgtcggccaactcgggt
gccaggcttggtgtcgccaatgagctgattccccacttcaaggttgcctggaccgacccg
agcaaccccaacaagggctttgactacctctacttgttggaggaggccaagaagaagttc
gaggagactgttatcactgaggagatcactgtagatggcgagacccgccacaagattgtc
accatcgtgggtgctgaggacggccttggtgtcgagtgcttgcgtggctctggtctcatt
gccggtgccaccagcagggcctacaacgacatcttcacctgcacactggttacctgccgc
tcagtcggtatcggtgcctaccttgtccgcctcggccagcgtgctgttcagatcgagggc
cagcccatcattctgactggtgcccctgccttgaacaacctgcttggtcgtgaagtttac
acttccaacctgcagctcggtggcacccagatcatgtaccgcaacggtgtctcgcacatg
actgccaacgatgacatggagggtatcgccaagatcatggaatggatgtcatttgtccct
gaccagcgcaacaggccagttcccatcatggctcctctggacaagtgggaccgcgaggtt
gacttcacgcctccccaacgccagccttacgacccgaggtggttgattgccggtaaggag
gatgctgatggcttccagtccggtctctttgaccgtggctccttcgttgagacccttggc
ggatgggccaggaccgtcgtcgtcggtcgtgctcgtctcggtggtatccccatgggtgtc
atcgccgtcgagactcgggctgtggagaacatcacccctgccgaccctgccaacgcagac
tcgatggagcaggtcaccaacgaggctggtggtgtgtggtaccccaactctgccttcaag
actgcgcaggccatcaacgacttcaacaacggtgagcagctgcctctcatgatccttgcc
aactggcgtggtttctcaggtggtcagcgcgacatgtacaacgaggttctcaagtacggc
tcgttcatcgtcgatgccctcgtcaagtacgagcagcccatctttgtctacattccgccg
cacggtgagcttcgtggtggatcgtgggttgttgtcgaccccacgatcaactcgacggtt
atggagatgtacgccgacaaggaggctcgtggtggtgtgcttgagcccgaaggtatcatt
ggtatcaagtacaagaaggagaagcagcttgagacgatggctcgcttggatcctgtctac
ggtgagctcaagaagcgcatgctggccgtgcaggcagctgccaaggacaagacaggcgca
gcggacaaggaggagcttgagcagatcaagaagcagatgacgcagcgtgaggagcagctc
ggccccatttaccagcagattgctatccagttcgccgatcttcacgatcgtgctggacgc
atgaaggccaagggtactatccgtgaggtcatcgagtggaaggaggcccgtcgcttcttc
tactggcgtgtgcgccgccgtatcaacgaggagtacctcatccgcaagatggcgcgtgcc
actgcaggactgtcaaagacaacctcggccaagatctcggagagtgctcgcaagggctac
ctgcgatccctggctgcctggaccgctgtccctgactttgaccatgaggacaggaaggtt
gcaacttggtatgaggagaacaccaagatcgtggaggagaagctcaaggcattgaagacg
gatgctgtcgcttccgagatcagcgctctcatccgtggtggcacttggactcacgaggag
gttgagacaccttcaacgccttctattgagaagagcaaggcgcctctggaggagtcaacg
gagccgaggagcccgacaggacccgtaccgacaaccgagaacgggctgagctcatcatgg
aagggcgtcagggacgtgttgcgcacgatgcccgtggaggacagagataagattctccag
ttcctgaaggagtag

DBGET integrated database retrieval system