KEGG   Magnaporthe oryzae: MGG_07613Help
Entry
MGG_07613         CDS       T01027                                 

Definition
acetyl-CoA carboxylase
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
mgr  Magnaporthe oryzae
Pathway
Fatty acid biosynthesis
Aflatoxin biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:mgr01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mgr00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mgr00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:mgr00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis [PATH:mgr00254]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 2344 aa AA seqDB search
MTETNGTAAAANSSRQRNGANGVTVPVANGKATYAQRHKIADHFIGGNRLENAPPSKVKE
WVAAHDGHTVITNVLIANNGIAAVKEIRSVRKWAYETFGDERAIQFTVMATPEDLQANAD
YIRMADHYVEVPGGTNNNNYANVELIVDVAERMNVHAVWAGWGHASENPKLPESLAASPK
KIIFIGPPGSAMRSLGDKISSTIVAQHAQVPCIPWSGTGVDAVQIDKKGIVTVDDDTYAK
GCVTSWQEGLEKARQIGFPVMIKASEGGGGKGIRKAVSEEGFEELYKAAASEIPGSPIFI
MKLAGNARHLEVQLLADQYGNNISLFGRDCSVQRRHQKIIEEAPVTIAKPDTFKAMEEAA
VRLGRLVGYVSAGTVEYLYSHADDKFYFLELNPRLQVEHPTTEGVSGVNLPASQLQIAMG
IPLHRISDIRLLYGVDPKLSTEIDFDFKNPDSEKTQRRPSPKGHLTACRITSEDPGEGFK
PSNGVMHELNFRSSSNVWGYFSVGTQGGIHSFSDSQFGHIFAYGENRSASRKHMVIALKE
LSIRGDFRTTVEYLIKLLETEAFEENTITTGWLDELISKKLTAERPDKMLAVVSGAVTKA
HLASEQCLNEYKAGLEKGQVPSKDILKTTFPIEFIYEGERYRFTVTRSSKDSYHLFINGS
NCSVGVRPLSDGGLLILLDGKSHNVYWKEEVGATRISIDNRTCLLEQENDPTQLRTPSPG
KLVKYTVESGDHIKAGQTFAEVEVMKMYMPLVAQEDGTVQLIKQPGSTLEAGDILGILSL
DDPSRVKQAQPFLNKLPEYGNPVITGNKPAQRFTQLHNILDNIMLGYDNTTVMRDSLLQL
IEVMRDPDLPYSEWNSQFSALHTRMPQKLEAQLSHVIDRARARQSEFPAKALKKTFHKFI
DEHVARQDAGLLKTTLAPLVDVLDLYEEGQKAHELKTMSNLIAKFIETEKLFSGRRLQDD
DVILKLRDENKDDIQKVVQTVLSHSRVPTKSLLVLAIIEEYRPNKPDVGNVTKYFRDVLK
KLTELESRLTAKVSIKAREVLIQCSLPSLDERKAQMEHILRSSVVESRYGEAAYDHRFPN
MDVIKEVVDSKYTVFDVLSLFWAHSDKWVSLAALEVYIRRAYRAYDLGKIDYQYDEEDDP
VFVSWDFVMKLSGDVEFGIGGPLQSAAPSSPATPNEFTFNRVTSLSDMSYLAKKTAEQPI
RKGVMVACKFFDDVDDDLPKALESLPMKGKLKRLGSSGPAAAIASQLDNKRRPAAASRDD
DELTAVVNVAIRDAESRDDDETLSRIKPLLASFKEELCARRVRRITFICGKNDASYPAYY
TFRGPNYDEDESIRHSEPALAFQLELDRLSKFKYKSVFTENKNIHVYEAIGRGVDTDKRY
FTRAVIRPGRLRDEIPTAEYLISEADRVVNDIFDALEIIGNNNSDLNHLFLNFIPVFNIH
PGEVEHALAGFLERFGSRGWRLRVSQVEIRIICTDQNSGAKLPIRCYINNTSGFVVKVEL
YHERRNDKGDLILHYISGTSKTGALHLLPANTPYPTKNWLQPKRYKAHLIGTQYVYDFPE
LFRQAIQLSWKKLEAQHSPIASKKPEEGECTHTLELVLDDQDNLQAIEREPGTNTCGMVG
WIITAFTPEYPSGRRFVVVANDITYSIGSFGPKEDHFFNKCTEYAQKLGIPRIYLSANSG
ARLGVANELIPHFKVAWTDPSNPNKGFDYLYLLEEAKKKFEETVITEEITVDGETRHKIV
TIVGAEDGLGVECLRGSGLIAGATSRAYNDIFTCTLVTCRSVGIGAYLVRLGQRAVQIEG
QPIILTGAPALNNLLGREVYTSNLQLGGTQIMYRNGVSHMTANDDMEGIAKIMEWMSFVP
DQRNRPVPIMAPLDKWDREVDFTPPQRQPYDPRWLIAGKEDADGFQSGLFDRGSFVETLG
GWARTVVVGRARLGGIPMGVIAVETRAVENITPADPANADSMEQVTNEAGGVWYPNSAFK
TAQAINDFNNGEQLPLMILANWRGFSGGQRDMYNEVLKYGSFIVDALVKYEQPIFVYIPP
HGELRGGSWVVVDPTINSTVMEMYADKEARGGVLEPEGIIGIKYKKEKQLETMARLDPVY
GELKKRMLAVQAAAKDKTGAADKEELEQIKKQMTQREEQLGPIYQQIAIQFADLHDRAGR
MKAKGTIREVIEWKEARRFFYWRVRRRINEEYLIRKMARATAGLSKTTSAKISESARKGY
LRSLAAWTAVPDFDHEDRKVATWYEENTKIVEEKLKALKTDAVASEISALIRGGTWTHEE
VETPSTPSIEKSKAPLEESTEPRSPTGPVPTTENGLSSSWKGVRDVLRTMPVEDRDKILQ
FLKE
NT seq 7035 nt NT seq  +upstreamnt  +downstreamnt
atgactgagacaaatggaaccgctgcggctgctaacagctcccgtcagcgcaacggcgcc
aacggcgtcaccgtgcctgtggccaacggcaaggctacttacgctcagaggcacaagatt
gccgaccactttattggcggcaacaggctagagaatgcccctccgtccaaggtcaaggag
tgggttgccgcacacgacggccacacagtcatcaccaacgtcctgattgccaacaacggt
atcgctgccgtcaaggagattcgatccgtgcgaaaatgggcatacgagacgttcggagac
gaaagggccattcagttcactgtgatggccactcccgaggatttgcaagcaaacgcagac
tacattcgcatggcagaccactacgtcgaggtccctggtggtacaaacaacaacaactat
gcgaacgtcgagttgatcgtcgatgttgcggagcgcatgaacgtgcacgccgtttgggcc
ggttggggacacgcatcggagaacccaaagctccctgagtctctcgctgcctcgcctaag
aaaattattttcatcggccctcccggctccgcgatgcgctcgctcggtgacaagatctct
tctaccattgtcgctcaacatgcccaggtcccatgtatcccctggtcgggaactggtgtt
gatgcggtccaaatcgacaagaagggaattgtcaccgtcgacgacgacacttatgccaaa
ggatgcgtcacttcatggcaggagggtcttgagaaggccagacaaattggtttcccggtc
atgatcaaggcttctgagggtggtggtggcaagggtatccgtaaggctgtctccgaggag
ggcttcgaggagctctacaaggccgctgccagtgaaatccccggttcgcccatcttcatc
atgaagcttgcaggcaacgccaggcatttggaagtgcagcttctcgctgatcagtacggc
aacaacatctccctctttggtcgtgattgttccgtccagcgaaggcaccaaaagattatc
gaggaagctcccgtgaccatcgccaagcccgacacgttcaaggccatggaggaggccgct
gttcgtcttggtcgtcttgtcggttacgtctctgctggtaccgtcgagtacctgtactcg
cacgccgacgacaagttctacttcctggagctcaaccctcgtcttcaggtcgagcatcct
accactgagggtgtcagtggtgtcaacctccccgcttcgcagcttcagattgccatgggt
atccctctccacaggatatctgacattaggctcctttacggtgtggaccccaagctctcg
actgagatcgactttgacttcaagaaccccgacagcgagaagacgcagaggaggccatcg
cccaaaggccaccttactgcctgccgtattacctcagaggaccctggagagggcttcaag
ccgtccaacggtgtcatgcacgagctgaacttccgcagtagttcaaacgtgtggggttac
ttctcagtcggtacgcagggtggaattcacagtttctccgacagtcagttcggtcacatt
ttcgcctatggcgagaaccgatccgcgtcaaggaagcacatggttatcgccttgaaggaa
cttagcattcgtggtgatttccgcaccacggtcgagtacctaatcaagcttctggagacg
gaggctttcgaggagaacaccattaccactggctggctggacgagcttatttcgaagaag
ctcactgcggagaggcccgacaagatgcttgctgttgtgtctggtgctgtcaccaaggcc
cacctggcgagtgaacaatgcctcaacgagtacaaggctggtcttgagaagggacaggtc
ccatctaaggacattctcaagaccacattccctatcgagttcatctacgagggagagcgg
taccgtttcaccgtcacgcgctcgagcaaagacagctaccatctcttcatcaacggttcc
aactgctccgtcggagttcgtcctctcagtgacggtggtctgctgatcttgctcgacggc
aagagtcacaacgtctactggaaggaagaggttggtgccactcgtatttctatcgacaac
aggacctgtcttctggaacaagagaacgaccccactcagctccgcactcccagccccggt
aagctggtcaagtacactgttgagagtggcgaccacatcaaggctggccagacctttgct
gaagtcgaggtcatgaagatgtacatgcctttggtagctcaggaggatggtacagtccag
ctgatcaagcagcctggctcaaccctcgaggctggtgacattctcggtatactctcactc
gacgaccctagccgcgtcaagcaggctcagccgttcctgaacaagcttcctgagtacggt
aaccctgtcatcaccggtaacaagcccgcccagcgcttcacgcagctgcacaacatcctc
gacaacatcatgcttggatacgacaacacaactgtcatgcgcgacagccttctgcagctc
atcgaggtcatgcgtgaccctgacctcccatacagcgagtggaactcacaattctcagcc
cttcacacccgtatgccgcagaagctggaggctcaattgagccatgttattgacagggct
cgggcgcgtcaatcggaattccccgcaaaggccttgaagaagacattccacaagttcatt
gacgagcatgttgcccgccaggatgctggcctgctcaagacgaccctggctcctctcgtc
gacgtgcttgatctttacgaggaaggacagaaggcacacgagctgaagaccatgtccaac
ttgattgccaagttcattgagactgagaaattgttctctggccgccgtctgcaggacgac
gacgttatcctgaagctgcgtgatgagaacaaggatgacattcagaaggttgttcagaca
gtactgtcacacagccgtgtccctaccaagagtcttcttgtccttgccatcatcgaggaa
taccgacccaacaagccggatgttggcaacgtcaccaagtatttccgtgacgtcctgaag
aagctcacggagctcgagtctaggctgaccgccaaggtttctatcaaagcgcgtgaggtc
cttattcaatgctctcttccctcgctcgacgagcgcaaggcgcagatggagcacatcctg
cgttcgtcggtcgttgagtcccgctacggcgaggccgcgtatgaccaccgtttccccaac
atggacgtgattaaggaggttgtcgactccaagtacactgtcttcgacgtattgagtctc
ttctgggcgcacagcgacaagtgggtctcgctggccgcactcgaggtctacattcgccgc
gcataccgtgcgtatgacctgggcaagattgactaccagtacgatgaggaggacgaccct
gtcttcgtcagctgggacttcgtcatgaagctgagcggtgatgtggagtttggaattggc
ggccctctgcagtctgctgctccatcttctccggctaccccgaacgagttcacgttcaac
cgcgtcacttctctcagcgacatgtcatacttggccaaaaagacagctgagcagcccatc
cgcaagggtgtcatggttgcttgcaagttctttgatgatgttgacgacgacctgccgaag
gccttggagagcctgcccatgaagggtaagctcaagaggctgggcagcagcggtcctgcc
gccgccattgcgtctcagctcgacaacaagcgccgaccggcagcagcatcccgtgacgat
gatgagctcacggctgttgtcaatgttgccattcgcgatgccgagagccgtgatgatgac
gaaaccctttcgcgcatcaagccactgcttgctagcttcaaggaggaactttgcgctcgt
cgtgtgcgccgcatcacgttcatctgtggcaagaacgacgcctcgtacccggcgtactac
accttccgtggtcccaactacgacgaagacgagagcattcgtcacagtgagccagctctt
gccttccagcttgagcttgatcgcctgtcgaagttcaagtacaagtcggtgttcaccgag
aacaagaacatccacgtgtacgaggctattggccgtggcgttgatactgacaagcgctac
ttcacacgtgcggtgattcggccaggtcgtctccgtgacgagatccccacggctgagtac
ctgatctccgaggccgacagagtggttaatgacatcttcgatgctcttgaaatcatcggc
aacaacaactctgatcttaaccacctcttcctcaacttcatccccgttttcaacatccac
cccggcgaggttgagcatgctttggctggtttcttggagcgctttggctcgcgcggctgg
cgccttcgtgtgtcccaggtcgagatcaggattatctgcactgatcagaacagcggcgct
aagctcccgatccgctgctacatcaacaacacctctggttttgttgtcaaggtcgagctg
taccacgagcgcaggaatgacaagggcgacttgatccttcactacatctcgggcactagc
aagactggtgctctccacttgctccctgccaacaccccgtaccctaccaagaactggctg
cagcccaagcgatacaaggcgcacctcatcggtacccagtacgtgtacgacttccccgag
ctgttcagacaagccattcagctcagctggaagaagctcgaggcgcagcactcgcccatc
gcctccaagaagccggaggaaggtgaatgcacccacaccctggagcttgtcctcgacgac
caagacaacctgcaagcgatcgagcgtgagcctggtaccaacacctgcggaatggtgggc
tggatcatcactgccttcacacccgagtaccccagcggtcgtcgcttcgtggttgtcgcc
aacgacattacctacagcatcggatctttcggacccaaggaagaccacttcttcaacaag
tgcacggaatatgcccagaagctcggcattcctcgcatctacctgtcggccaactcgggt
gccaggcttggtgtcgccaatgagctgattccccacttcaaggttgcctggaccgacccg
agcaaccccaacaagggctttgactacctctacttgttggaggaggccaagaagaagttc
gaggagactgttatcactgaggagatcactgtagatggcgagacccgccacaagattgtc
accatcgtgggtgctgaggacggccttggtgtcgagtgcttgcgtggctctggtctcatt
gccggtgccaccagcagggcctacaacgacatcttcacctgcacactggttacctgccgc
tcagtcggtatcggtgcctaccttgtccgcctcggccagcgtgctgttcagatcgagggc
cagcccatcattctgactggtgcccctgccttgaacaacctgcttggtcgtgaagtttac
acttccaacctgcagctcggtggcacccagatcatgtaccgcaacggtgtctcgcacatg
actgccaacgatgacatggagggtatcgccaagatcatggaatggatgtcatttgtccct
gaccagcgcaacaggccagttcccatcatggctcctctggacaagtgggaccgcgaggtt
gacttcacgcctccccaacgccagccttacgacccgaggtggttgattgccggtaaggag
gatgctgatggcttccagtccggtctctttgaccgtggctccttcgttgagacccttggc
ggatgggccaggaccgtcgtcgtcggtcgtgctcgtctcggtggtatccccatgggtgtc
atcgccgtcgagactcgggctgtggagaacatcacccctgccgaccctgccaacgcagac
tcgatggagcaggtcaccaacgaggctggtggtgtgtggtaccccaactctgccttcaag
actgcgcaggccatcaacgacttcaacaacggtgagcagctgcctctcatgatccttgcc
aactggcgtggtttctcaggtggtcagcgcgacatgtacaacgaggttctcaagtacggc
tcgttcatcgtcgatgccctcgtcaagtacgagcagcccatctttgtctacattccgccg
cacggtgagcttcgtggtggatcgtgggttgttgtcgaccccacgatcaactcgacggtt
atggagatgtacgccgacaaggaggctcgtggtggtgtgcttgagcccgaaggtatcatt
ggtatcaagtacaagaaggagaagcagcttgagacgatggctcgcttggatcctgtctac
ggtgagctcaagaagcgcatgctggccgtgcaggcagctgccaaggacaagacaggcgca
gcggacaaggaggagcttgagcagatcaagaagcagatgacgcagcgtgaggagcagctc
ggccccatttaccagcagattgctatccagttcgccgatcttcacgatcgtgctggacgc
atgaaggccaagggtactatccgtgaggtcatcgagtggaaggaggcccgtcgcttcttc
tactggcgtgtgcgccgccgtatcaacgaggagtacctcatccgcaagatggcgcgtgcc
actgcaggactgtcaaagacaacctcggccaagatctcggagagtgctcgcaagggctac
ctgcgatccctggctgcctggaccgctgtccctgactttgaccatgaggacaggaaggtt
gcaacttggtatgaggagaacaccaagatcgtggaggagaagctcaaggcattgaagacg
gatgctgtcgcttccgagatcagcgctctcatccgtggtggcacttggactcacgaggag
gttgagacaccttcaacgccttctattgagaagagcaaggcgcctctggaggagtcaacg
gagccgaggagcccgacaggacccgtaccgacaaccgagaacgggctgagctcatcatgg
aagggcgtcagggacgtgttgcgcacgatgcccgtggaggacagagataagattctccag
ttcctgaaggagtag

DBGET integrated database retrieval system