KEGG   Magnaporthe oryzae: MGG_07763Help
Entry
MGG_07763         CDS       T01027                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mgr  Magnaporthe oryzae
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MGG_07763
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     MGG_07763
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGG_07763
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 507 aa AA seqDB search
MRTAVTAIAMVAWAALSVQAVPSAKNFIYIVPDGFGPASQTMARDYVSLIQNGENPDRPV
GFQLPGDKMVLGNVRTHASDALVTDSAASGTAFACGIKTYNAAIGVNDAVEPIGSILEAA
HLSGMKTGLVVTSTINHATPASYSAHVAHRDMYADIAKHQIGYNHPFGPFVDILMGGGRC
YYKPQGESGSCRPDDADLFGFAQENGYHVMQNRTAFDALDKGLGDTNLPFIGLFNDGQMM
YEIDRSRNPTQEPSLLEMAETAINALDRATSSGDKGYFLMIEASRIDHAGHANDPASHLF
DIIMYNEVLEYVQKWIDEHPDTMLMSAADHECGALTLPGYNPLPMKAATASTEALVRRYD
EFSGDKRAFLRSEILPAYGLADATDAEFNTLLSSGNLGSEMGNLLASRAGIHWASGGHSA
VDVVLYGYASSDKLAEYKASMAGNHDNTALPKFVEQVLGIDMSAATELIRANATEGWMGT
PPTNFRTSTHAHGDHDPTHQQMLPLFR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgcgcactgcagtgacggctatcgccatggtggcctgggcggctctgagcgtccaggca
gtgccgtcggccaagaacttcatctacatcgttccggatggcttcgggccggcgtcgcag
accatggccagggactacgtgtccctcatccagaacggcgagaaccctgaccggccggtt
gggttccagctcccgggtgacaagatggttctgggcaacgtgcggacacacgccagcgac
gcgctggttaccgactcggcagcttcgggaactgcatttgcctgcggtatcaagacttat
aacgcagctatcggtgtcaacgacgccgtcgagcctattggctcgatcctggaggcggcg
catctctcaggcatgaagaccggtctggtagtcaccagcacgatcaaccacgccacgccg
gcttcctactctgctcatgttgctcacagagacatgtatgcggatatcgccaagcatcaa
atcggatacaaccacccatttggcccctttgtggacattttgatgggtggtggtcggtgc
tactacaagccgcaaggagagagtggctcctgcaggcctgacgacgcagacctcttcggc
ttcgcgcaagagaatggttaccacgtgatgcagaaccgcaccgcgtttgacgccctcgac
aagggtctcggggacaccaacctgccgttcatcggcctgttcaacgacggtcagatgatg
tacgagatcgacaggtcacgcaacccgacgcaggagccgtcgctgctggagatggccgag
acggccatcaacgctctggaccgggcgacgagctcaggtgacaagggctacttcctcatg
atcgaggcgtcccgcatcgaccacgcaggccacgccaacgaccctgcatcgcacctgttc
gacatcatcatgtacaacgaggtgctggagtacgtgcaaaagtggatcgacgagcacccc
gacacgatgctcatgtcggcggcggatcacgaatgcggcgccctgacgctcccggggtac
aaccccctgccgatgaaggcggccacggcgtcgaccgaggcgctggtcaggcgctacgat
gagttttccggcgacaagcgggcattcctgcggtccgagatcctgcctgcgtacggcctg
gccgacgccaccgacgccgagttcaacaccctgctgtcctcaggcaacctgggatccgag
atgggcaacctgctcgcgtcgcgggcgggcatccactgggcttcgggcgggcactcggcg
gtcgacgtggtcctgtacggatacgcgtccagcgacaagctcgccgagtacaaggccagc
atggcgggcaaccacgacaacactgccctgcccaagtttgtcgagcaggtcctgggtatc
gacatgtcggcagccaccgagctgatccgcgccaacgccaccgagggctggatgggcacg
ccaccgaccaactttaggacgagcacgcatgcgcatggcgaccacgaccccacgcaccaa
cagatgctgcctctgtttcgttaa

DBGET integrated database retrieval system