KEGG   Magnaporthe oryzae: MGG_07768Help
Entry
MGG_07768         CDS       T01027                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
mgr  Magnaporthe oryzae
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    MGG_07768
Exosome [BR:mgr04147]
 Exosomal proteins
  Proteins found in most exosomes
   MGG_07768
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 1680 aa AA seqDB search
MAPLPIKFTELLQLSAVGVDTSAIGFNSCTLESDHYVCIREKKNEAASPEVVIIDLKNNN
NVTRRPIKADSAIMHFTRQVIALRAQSRTLQIFDLEAKQKLKSTTMNEDVVFWKWISDTT
IGLVTDAAVYHWDVFDANQATPVKQFARNDNLSGNQIINYRANSEGKWMVVVGIAQAQGR
VVGNMQLYSKDRGISQSIEGHAAAFGTLRLEGAPQDTKVFTFAVRTATGAKLHIVEVDKP
EANPAFAKKNVDVYFPAEAVNDFPVAVQVSQKYGVIYLVTKYGFIHLYDLENGTCIFMNR
ISSETIFTTSPDGDSTGIVSINRKGQVLGVTIDDETMIPYLLQNPANTELAIKMASRAGL
PGADQLYGQQFQQLFNGGNYMEAAKVAAGSPRGFLRTAETINKFKNLPQQPGQMSYILQY
FGLLLDKGSLNHHETIELAQPVLAQNRKQLLEKWLNEGKLDCSEQFGDMVRPHDVSMALK
IYLKANVPQKVVAGLAETGQFDKILPYCAQTGYQPDWIQLLNHIVRINPEKGAELATTLA
NHEGGSLVDIARVVDVFQAQGMVQQATAFLLDALKDNKPEHADLQTRLLEMNLMNAPQVA
DAILGNEMFTYFDKGRIAALCEQAGLHQKALELYEDPAAVKRVVVNIAGMPNFNPEWLVN
FFGKLSVEQSLDCLDAMMKTNIRQNLQSVVQVATKYSDLLGPTKLIDLFEKYKTAEGLFY
YLGSIVNLSEDPDVHFKYIEAATKMGQFSEVERICRDSNYYNPEKVKNFLKEAKLTEQLP
LIIVCDRFNFVHDLVLFLYQNQQFKSIEVYVQRVNPARAPAVIGGLLDVDCDEAIIKNLL
STVDPASIPIDELVAEVETRNRLKMLLPFLEATLQAGNQQQAVFNALAKIYIDSNNNPEK
FLKENDQYDSLVVGKYCEKRDPNLAYIAYRKGGNDLELVNITNENSMYKAQARYLLERAD
RELWMFVLSENNIHRRSVVDQVTSTAVPESTDPAKVSEAVAALLAADLPGELIELLEKIV
LEPSPFSDNQNLQNLLMFTAAKADKSRVMDYIHKLDGFNPQEITAVCIDVGLYEEAFEIF
KKIDDKVSAVNVLVENVVSIDRAQAYAEDVDIPEVWSKVAKAQLDGLRVTDSIESYIKAE
DPKNYLEVIEIATHAGKNEDLVKYLRMARKTLRETAIDTALAFCYARLDQLSELEDFLRG
TNVTNIEESGDKAYGEGLFEAAKIFYTSISNWAKLATTLVHLGDYQAAVECARKANSIKV
WKEVHEACVNKKEFRLAQICGLNLIVDAEQLQTLVKQYERNGFFDELISLLENGLGLERA
HMGMFTELGIALSKYHPERLIEHLNLFWSRMNLPKMIRACEEANLWPELVFCYVHYDEFD
NAALSVIERPENSWEHTQFRDIIVKVANLEIYFKAINFYLEQHPSLLTDLLQALTPRIDV
NRVVRMFQKSDNLPLIKPFLLNVQTQNKRIVNDAINDLLIEEEDYKTLRDSVENYDNYEP
VELAGRLEKHDLVFFRQIAASIYRKNKRWEKSIALSKQDKLWKDAIETAAISVKSEVVEE
LLRYFVDIGNRECYVGMLYACYDLIRPDLVLEMSWRHGLHDFTMPYMINLLSQQTKELAV
LKADNEARKAKEKEQEKKEDNAPILGGGRLMITAGPGTQPTSPAPFGANGFAPQPTGYGY
NT seq 5043 nt NT seq  +upstreamnt  +downstreamnt
atggcgcctcttccgatcaagttcaccgagctgctgcagctatcagctgtgggcgtcgac
acttcggccattggcttcaactcctgcacactagagtcggatcactacgtctgcattcgc
gaaaagaagaacgaggcagcatcaccagaagttgtcatcatcgacctcaagaacaacaac
aatgtcactagacgccccatcaaggccgacagtgccatcatgcacttcaccagacaggtc
atcgcccttcgcgcacaatcaagaacgttgcagattttcgacctggaggccaagcaaaag
ctcaagtccacaacgatgaacgaagatgtggtcttttggaagtggatcagtgatactaca
attggtcttgttactgacgcggccgtgtaccactgggatgttttcgatgccaaccaagcc
actcccgtgaagcagtttgcccgaaacgataacctgagcggcaaccaaatcatcaactac
cgcgctaattccgagggcaagtggatggttgtcgtgggtatcgctcaggcgcaagggcgc
gtggtgggcaacatgcagctctactcaaaggacagaggtatcagccaatccatcgagggt
cacgccgcagccttcggaaccctgaggttggagggtgcccctcaagataccaaggtcttt
acattcgccgtcaggactgccacgggcgccaagctgcacattgttgaggtcgacaagcca
gaagccaacccggcatttgcgaagaagaacgtcgacgtctacttccccgccgaggccgtc
aacgacttccccgtcgcggtgcaggtttcgcaaaagtacggcgtcatatacttggttacc
aagtacggcttcatccacctttacgacctcgagaatggcacctgcatcttcatgaaccgc
atctcgagcgaaaccatcttcaccaccagccccgacggagactctaccggcatcgtcagc
atcaaccgcaagggtcaggttctcggcgtgacaatcgacgacgagaccatgatcccctac
ctgctgcaaaaccccgctaataccgagcttgcaatcaagatggcttctcgtgccggtctc
cctggtgcagaccagctgtacggccagcagttccagcagctcttcaacggtggcaactac
atggaggctgctaaggtcgccgccggttcgccccggggattcctgcggacggccgagacc
atcaacaagttcaagaacttgccccaacagcctggccaaatgtcctacattcttcagtac
tttggtctgctcctcgacaagggatccctcaaccaccacgagacgatcgagctggcccag
cctgtactggcccagaaccgcaagcagctgctcgagaagtggctgaacgagggcaagctg
gactgttccgagcagtttggtgacatggttaggccgcacgacgtctcgatggcgctcaag
atctacctcaaagccaacgtcccacaaaaggttgttgccggtctggccgagacgggtcag
ttcgacaagatcctgccgtactgcgctcaaactggctaccagcccgactggatccagctg
ctgaaccacattgtgcgcatcaaccccgagaagggtgccgagctggccacgactcttgcg
aaccatgagggcgggtcccttgtcgacatcgcccgtgttgtagatgttttccaggcccag
ggcatggttcagcaggccacggccttccttttggacgctctcaaggacaacaagcccgag
cacgccgacctgcagaccaggcttttggagatgaacctgatgaacgccccccaggttgcc
gatgccatcttgggcaacgagatgtttacgtatttcgacaagggtcgcattgctgccctg
tgtgagcaggcgggcttgcaccagaaggcgctcgagctctatgaggatcctgctgccgtc
aagcgcgttgttgtcaacattgctggcatgcccaactttaaccccgaatggctcgtcaac
ttctttggcaagctgtctgtggagcagtctttggactgcctcgatgccatgatgaagaca
aacattcgccagaacctgcagtcggtcgttcaggttgccaccaagtactcggatctcctg
ggccctaccaagctgattgatctctttgagaagtacaagactgccgagggtctcttctac
tacctcggtagcatcgtcaacctgtcagaggaccctgacgtccacttcaagtacatcgag
gccgccaccaagatgggtcagttcagcgaggttgagcgtatctgcagagacagcaactac
tacaaccccgagaaggtcaagaacttcctcaaggaggccaagttgacggagcaactgcct
ctgatcattgtgtgcgaccgtttcaactttgtccacgatttggttcttttcctgtaccag
aaccagcagttcaagtccatcgaggtgtacgtccagcgcgtcaaccctgcacgtgccccc
gccgtcattggcggtctcttggacgttgactgtgatgaggccatcatcaagaacctgctt
tccactgtggaccccgcttctatccccatcgatgagctcgtcgccgaggttgagactagg
aatcgcctcaagatgcttctgcccttcctcgaggctactcttcaggccggcaaccagcag
caggccgttttcaacgccctcgccaagatctacattgactccaacaacaaccctgagaag
ttccttaaggagaacgaccagtatgattcgctcgtggtcggaaagtactgcgagaagcgt
gaccccaaccttgcctacattgcctaccgcaagggtggcaacgacttggagcttgtcaac
atcaccaacgagaactccatgtacaaggcccaagcacgttaccttctcgagcgtgctgac
cgtgagctgtggatgtttgtcctgagcgaaaacaacatccaccgtcggtccgttgttgac
caggtcacttcgactgccgttccagagtcgaccgaccccgccaaggtttcagaggctgtc
gctgcccttttggcagctgatctgccaggcgagctcattgagcttttggagaagattgtt
ctggagccatcgccgtttagcgacaaccagaacctccagaacctcctcatgttcaccgct
gccaaggctgacaagtcccgtgtgatggactacattcacaagctggatggcttcaaccct
caagagatcactgccgtttgtatcgacgtcggcctgtacgaggaggcttttgagatcttc
aagaagattgacgacaaggtcagcgccgtcaacgtcctcgtcgagaatgttgtcagcatc
gaccgcgcacaggcctacgccgaggatgtggatattcccgaagtctggagcaaggttgcc
aaggcccagcttgatggtctgcgtgtcacagactctatcgagtcatacatcaaggctgaa
gaccctaagaactacctggaggttattgagatcgctacgcacgccggcaagaatgaggac
ctcgtcaagtatctgcgcatggcccgcaagacactccgcgagaccgccatcgacactgct
cttgctttctgctacgctcgcctggaccagctctctgagctcgaggacttcctccgtgga
acgaacgttaccaacatcgaggagtctggtgacaaggcatacggcgagggtctctttgag
gctgccaagatcttctacactagcatttccaactgggccaagctcgccaccaccctcgtt
catctcggtgactaccaagcagctgtcgaatgtgcccgcaaggccaacagcatcaaggtg
tggaaggaggtccacgaggcatgcgtcaacaagaaggagttccgtctggcacagatttgc
ggtctcaacttgattgtggacgctgagcagcttcagaccctcgtcaagcaatatgagcgc
aacggcttctttgacgagctcatcagcttgcttgagaacggtcttggtctggagcgtgcg
cacatgggaatgttcaccgagcttggtatcgctttgtccaagtaccaccctgagcgcctg
attgagcaccttaacctgttctggagcaggatgaacctgcccaagatgattcgtgcatgc
gaggaggcaaacctctggcccgagcttgtcttctgctacgtccactacgatgagtttgat
aacgctgccctctccgtcattgagaggccagagaactcgtgggagcacacacaattcagg
gatatcatcgtcaaggttgccaacttggagatttacttcaaggccatcaacttttacctg
gagcagcacccctccctgttgactgacctgttgcaggctttgacgcctcgtattgatgtc
aaccgtgttgtcaggatgttccaaaagtcggacaacctgcccttgatcaagcccttcctg
ctgaacgtgcagactcaaaacaagcgcatcgtcaacgatgccatcaacgaccttctaatc
gaggaggaggactacaagacgctgcgcgactcggtcgagaactacgacaactatgagcct
gtcgagcttgctggacgcctcgagaagcacgaccttgtctttttccgccagatcgccgcc
agcatttaccgcaagaacaagcgctgggagaagtcgattgctctttccaagcaggacaag
ctgtggaaggatgccattgagacggctgccatctcggtcaagtcggaggttgtggaggag
ttgctgcgctactttgtcgacattggcaaccgcgagtgctacgttggtatgctctatgcc
tgctacgacctcatcaggcccgacttggttcttgagatgtcatggcgccacggcctgcac
gatttcacaatgccatacatgatcaacctcctgtcacagcagaccaaggagcttgctgtt
ctcaaggcagacaacgaggctcgcaaggccaaggagaaggagcaggaaaagaaggaggac
aatgctcctattctcggtggcggacgtctcatgattacggctggacctggtacacaaccg
acctctcctgcgccttttggagcgaatgggttcgcaccgcagcctaccggatatggttac
tag

DBGET integrated database retrieval system