KEGG   Magnaporthe oryzae: MGG_08011Help
Entry
MGG_08011         CDS       T01027                                 

Definition
(RefSeq) D-amino-acid oxidase
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00260  Glycine, serine and threonine metabolism
mgr00330  Arginine and proline metabolism
mgr00472  D-Arginine and D-ornithine metabolism
mgr01100  Metabolic pathways
mgr01130  Biosynthesis of antibiotics
mgr04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MGG_08011
   00330 Arginine and proline metabolism
    MGG_08011
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    MGG_08011
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    MGG_08011
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    MGG_08011
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     MGG_08011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO NAD_binding_8 Thi4 Pyr_redox_2 FAD_binding_2 Trp_halogenase Sacchrp_dh_NADP Pyr_redox
Motif
Other DBs
NCBI-GeneID: 2678277
NCBI-ProteinID: XP_003714961
UniProt: G4MX56
Position
2
AA seq 363 aa AA seqDB search
MPKIVVLGAGVSGLTAALLLSRNKDNDITVIAKHMPGDYDIEYASPWAGANVLPMNTVED
SRWERRTFPELKRLAEEVPEAGIHLLKVRLFRRTPASEDNETQTALDPIFAKDPWYSEMF
DDFRTLSKDELPDGVVSANEFGSVCINTMLYLPWLVGQCRANGVVFNRANLTHIAEAAAR
HHSGAKADLVVNATGVTACKLGGVMDAAVQPARGQVVVVRNELPLMLGATLAAEDDAEHP
DEMVYCMTRAAGGGTVIGGCYQKGNWDPNPDPNLAVRIMSRMVEFWPEIADGKGVAGLDV
IRHGVGLRPYREGGVRIEKERLSDGTWVVHNYGHAGWGYQGSYGCAERVVELVDESFKGK
PKL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccaaagatagtggtactaggggcgggtgtttcgggccttactgctgcccttctgctt
tcacggaacaaggacaatgatatcacggtaattgcaaagcatatgcctggcgactatgat
atcgaatatgcctcaccatgggcaggagccaatgtcttgccaatgaacaccgtggaagac
agccgctgggaacggcggacgtttccagagttgaagcgactggctgaagaggttcccgag
gccgggatacacctactgaaggtacgcttgttccgacgcacacctgcctcggaagacaac
gaaacccagaccgcgctggaccccatattcgccaaggacccatggtacagcgaaatgttt
gacgacttccgaaccctgagcaaggacgagcttcctgacggcgtggtgtccgccaacgag
ttcggctccgtgtgcatcaacacgatgctgtacctaccgtggctcgtaggtcagtgccgg
gccaacggcgtcgtcttcaatcgcgccaacctcacccacatcgccgaggcggcagcgcgt
caccacagcggcgccaaggcagacctggtcgtcaacgcgacgggcgtcacggcgtgcaag
ctgggcggcgtcatggacgcggcggtgcagcccgccaggggccaggtagtcgtcgtgcgc
aacgagctcccgctcatgctgggcgcgaccctggctgccgaagacgacgcagagcacccg
gatgagatggtgtattgcatgacgcgagctgcgggtggagggactgtcattggcgggtgc
taccaaaagggcaattgggatccaaacccggatccgaacctggctgtgcggatcatgtcc
cgcatggtcgaattctggccagagattgcggacgggaagggggttgctggcttggatgtc
atccgtcacggagttgggctgaggccgtacagggagggaggtgtcaggatagagaaggag
aggttgagtgacgggacgtgggttgtgcacaattatggacatgcgggttggggttaccag
gggtcctatggctgcgcagagcgcgtggtcgagctggtcgacgagtcttttaagggaaaa
ccgaagctgtaa

DBGET integrated database retrieval system