KEGG   Magnaporthe oryzae: MGG_08270Help
Entry
MGG_08270         CDS       T01027                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
mgr  Magnaporthe oryzae
Brite
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     MGG_08270
Peptidases [BR:mgr01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   MGG_08270
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   MGG_08270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 787 aa AA seqDB search
MACTHLESLSLQPPTPAQSVYREDCTQCFDSIDGPDGLDVCLQCFNGGCVGERYHAKLHH
LIWSHPLVLNVRRTRKHIDRDEPPMKMSKLAIAAETEADRYDYHTKVKCLDCESELDKAH
PKLAKVVDGVMTANTFSRKEEVKAWEQELTSCEHILTLQQDEPRQIASNELGTCSKCDLN
ENLWLCLQCGALGCGRAQFGGVSGHSHALAHATESGHGVAVKLGSITPEGTADVYCYSCD
EERVDENLGHHLANYGINIAEREKTEKSLTEMQIEQNLRWEFSMTTEDGKELKPLFGPGL
TGLKNLGNSCYLASIIQCLFDMDAFQKRYGQVTQELPGIQDPAADLETQLRKIGDGLLSG
RYSKPDSDVVASEHSAELPYQKGLQPSMLKHLVGRGHEEFSTMRQQDAFELLQHLIKLIS
RAKHPSPADDPTQDFRFILEQRLQCLGCKKVRYTTNEQDSIFIDVPLEKLPVEEGGETEG
NTGAAYKPVTLSECLDRFTAEEIVELTCSSCGSKAGYTKRSCFKTLPQVLVVNARKMTIV
NWVPIKVDVPVLVNDDPYLLDNYLSQGQQPGEELLPEDASSSSAPAFTPNPEAVAQLEAM
GFPRNRCEKALHATGNSDANTAMEWLFGHMEDPDIDEPLKLEGSGDGAGGFTADPSSIEM
LGAMGFDAKKSTKALKETSGNVERAVEWLFSHPDDDGSMEDDSAAASGEKPPAGKSDVPA
QYQLKSIVCHKGTSIHAGHYVAFIRKQLQQDKPAWVLFNDEKVVEVVDVEEMKKFAYIYF
FNRVGSS
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcacacacttggagtcgctgtctctgcagcctcccaccccagcccagtcagtc
tatcgtgaggactgcacccagtgttttgactcgattgatggccccgacggcctcgatgtt
tgcctgcaatgtttcaacggcggttgcgtcggagagcgatatcacgcaaagcttcaccac
ctaatctggagccaccctcttgtcctcaatgtccggcgcacccggaagcacatcgaccgc
gatgaacccccgatgaaaatgtcaaagctcgccattgccgccgagaccgaagccgatcga
tacgactaccacaccaaggtcaaatgcctcgactgcgaatcggagctggacaaggcgcat
cctaaacttgccaaggtggttgatggcgtcatgacggcaaacacgttctcacgcaaggaa
gaggttaaggcctgggagcaggagcttaccagctgtgaacacatccttaccctccagcag
gacgagccgaggcagattgcatccaacgaactgggcacgtgctccaaatgcgatctcaac
gagaacctgtggctttgtcttcaatgtggtgcactgggctgtggacgggcgcagtttggc
ggtgttagcggtcactcccatgcattggcacatgcaaccgaatctggacacggcgtcgcc
gtcaagcttggatccatcaccccggaaggcaccgctgacgtctactgctactcttgtgac
gaggagcgagtggatgagaaccttgggcaccacttggccaactacggcatcaacattgca
gagcgtgagaagacggagaagagcttgaccgagatgcagatcgagcagaatttaagatgg
gaattctcaatgacgacagaggatggcaaagagctcaagcctctttttggtcctggactt
accggtctcaagaacctaggcaacagttgctacctcgcaagcataattcagtgtctgttt
gacatggatgcattccagaagcggtacggtcaggtcacccaggagcttcctggaattcag
gacccggctgcagatctcgagacccagctgcgcaagattggtgacggtctgctgtcgggc
cgttattccaagcccgattccgacgttgtggcatcagagcattccgcagaactgccctac
caaaaaggtctgcagccatcaatgctcaagcacctcgttgggcggggacatgaggagttc
tctacaatgcggcagcaggatgcttttgaactcctacagcatctcatcaagctcatctca
cgagcaaagcacccatcgccggccgacgaccccacacaagacttccgattcattctcgaa
caacggctccaatgtctgggttgcaaaaaggtgcgctatacgaccaatgagcaggatagc
atctttattgatgtacccctggaaaagttgccggtcgaagagggaggggagacggaaggc
aacactggtgctgcgtacaagcctgtcactctttccgagtgtctcgaccggtttactgcc
gaggagattgtcgaactcacatgctcttcatgtggaagcaaggccggctacaccaaaaga
tcttgcttcaagacactgccgcaggtcctagttgtcaatgcacgcaagatgaccattgtg
aactgggtgcctatcaaggttgatgtaccggtcttggtgaatgatgacccctaccttttg
gacaactatctgtcccagggacaacaacctggcgaagagctacttccagaggatgcttcg
tctagctcggcacccgcattcacacccaacccagaggccgtcgctcaacttgaggcaatg
ggcttccctcgcaaccgatgcgaaaaggctctacacgccacgggtaactccgatgccaac
acagccatggagtggttgtttggccacatggaagaccctgacatcgatgaacccctcaag
ctcgagggttccggtgacggtgctggaggattcacggcagatcctagctccattgagatg
cttggcgctatgggattcgatgctaagaaatcgacaaaagccctcaaggagacgtcagga
aatgtcgagcgagctgtagagtggcttttcagccatccagatgatgatggctctatggaa
gacgactcggccgctgcttcgggcgaaaagccacctgctggcaagagtgacgttccagcg
cagtaccagctcaagagcatcgtgtgccacaagggaacgagcattcatgctggtcactac
gttgcttttatccgcaaacagttgcaacaagacaagcccgcctgggttctgttcaatgac
gaaaaggttgtcgaggtggtcgacgtggaggagatgaagaagtttgcctacatctacttc
ttcaaccgggttggctcttcttag

DBGET integrated database retrieval system